Ncbi-mime-asn1 ::= strucseq { structure { id { mmdb-id 11440 }, descr { name "1IGR", pdb-comment "remark 3: Refinement.", pdb-comment "remark 3: Program : Refmac", pdb-comment "remark 3: Authors : Murshudov,Vagin,Dodson", pdb-comment "remark 3: Data Used In Refinement.", pdb-comment "remark 3: Resolution Range High (Angstroms) : 2.60", pdb-comment "remark 3: Resolution Range Low (Angstroms) : 7.0", pdb-comment "remark 3: Data Cutoff (Sigma(F)) : 2.000", pdb-comment "remark 3: Completeness For Range (%) : 97.0", pdb-comment "remark 3: Number Of Reflections : 26963", pdb-comment "remark 3: Fit To Data Used In Refinement.", pdb-comment "remark 3: Cross-Validation Method : Throughout", pdb-comment "remark 3: Free R Value Test Set Selection : Random", pdb-comment "remark 3: R Value (Working + Test Set) : Null", pdb-comment "remark 3: R Value (Working Set) : 0.237", pdb-comment "remark 3: Free R Value : 0.304", pdb-comment "remark 3: Free R Value Test Set Size (%) : 10.000", pdb-comment "remark 3: Free R Value Test Set Count : 2693", pdb-comment "remark 3: Number Of Non-Hydrogen Atoms Used In Refinement.", pdb-comment "remark 3: Protein Atoms : 3686", pdb-comment "remark 3: Nucleic Acid Atoms : 0", pdb-comment "remark 3: Heterogen Atoms : 166", pdb-comment "remark 3: Solvent Atoms : 48", pdb-comment "remark 3: B Values.", pdb-comment "remark 3: From Wilson Plot (A2) : Null", pdb-comment "remark 3: Mean B Value (Overall, A2) : 52.30", pdb-comment "remark 3: Overall Anisotropic B Value.", pdb-comment "remark 3: B11 (A2) : 8.12", pdb-comment "remark 3: B22 (A2) : -13.10", pdb-comment "remark 3: B33 (A2) : 0.98", pdb-comment "remark 3: B12 (A2) : 0.00", pdb-comment "remark 3: B13 (A2) : 0.00", pdb-comment "remark 3: B23 (A2) : 0.00", pdb-comment "remark 3: Estimated Overall Coordinate Error.", pdb-comment "remark 3: Esu Based On R Value (A): Null", pdb-comment "remark 3: Esu Based On Free R Value (A): Null", pdb-comment "remark 3: Esu Based On Maximum Likelihood (A): Null", pdb-comment "remark 3: Esu For B Values Based On Maximum Likelihood (A2): Null", pdb-comment "remark 3: Rms Deviations From Ideal Values.", pdb-comment "remark 3: Distance Restraints. Rms Sigma", pdb-comment "remark 3: Bond Length (A) : 0.017 ; 0.020", pdb-comment "remark 3: Angle Distance (A) : 0.048 ; 0.040", pdb-comment "remark 3: Intraplanar 1-4 Distance (A) : 0.051 ; 0.050", pdb-comment "remark 3: H-Bond Or Metal Coordination (A) : Null ; Null", pdb-comment "remark 3: Plane Restraint (A) : 0.038 ; 0.040", pdb-comment "remark 3: Chiral-Center Restraint (A3) : 0.149 ; 0.150", pdb-comment "remark 3: Non-Bonded Contact Restraints.", pdb-comment "remark 3: Single Torsion (A) : 0.219 ; 0.300", pdb-comment "remark 3: Multiple Torsion (A) : 0.296 ; 0.300", pdb-comment "remark 3: H-Bond (X...Y) (A) : 0.226 ; 0.300", pdb-comment "remark 3: H-Bond (X-H...Y) (A) : Null ; Null", pdb-comment "remark 3: Conformational Torsion Angle Restraints.", pdb-comment "remark 3: Specified (Degrees) : Null ; Null", pdb-comment "remark 3: Planar (Degrees) : 6.000 ; 7.000", pdb-comment "remark 3: Staggered (Degrees) : 24.100; 15.000", pdb-comment "remark 3: Transverse (Degrees) : 28.100; 20.000", pdb-comment "remark 3: Isotropic Thermal Factor Restraints. Rms Sigma", pdb-comment "remark 3: Main-Chain Bond (A2) : 3.721 ; 3.000", pdb-comment "remark 3: Main-Chain Angle (A2) : 5.407 ; 5.000", pdb-comment "remark 3: Side-Chain Bond (A2) : 7.903 ; 6.000", pdb-comment "remark 3: Side-Chain Angle (A2) : 9.046 ; 7.000", pdb-comment "remark 3: Other Refinement Remarks: Planar Restrain For Peptides,", pdb-comment "remark 3: Rms0.0384, Sigma0.04, Aromatic Planes Rms 0.0097,", pdb-comment "remark 3: Sigma0.015", pdb-comment "remark 4: 1igr Complies With Format V. 2.3, 09-July-1998", pdb-comment "remark 7: Positions Of Atoms With B Greater Than 75 Are Not Reliable.", pdb-comment "remark 7: Atoms Have Been Given Occupancy Of 0.01 Or Omitted If No", pdb-comment "remark 7: Electron Density Was Observed.", pdb-comment "remark 8: For Residues 457-459 The Density Was Notably Weaker Than", pdb-comment "remark 8: The Adjacent Residues. This Section Has Been Included With", pdb-comment "remark 8: Occupancy Of 0.5", pdb-comment "remark 9: Little Or No Electron Density Was Observed For Residues Of", pdb-comment "remark 9: The Enterokinase Cleavage Site", pdb-comment "remark 100: This Entry Has Been Processed By Rcsb On 16-Jul-1999.", pdb-comment "remark 100: The Rcsb Id Code Is Rcsb007214.", pdb-comment "remark 200: Experimental Details", pdb-comment "remark 200: Experiment Type : X-Ray Diffraction", pdb-comment "remark 200: Date Of Data Collection : 15-Nov-1996", pdb-comment "remark 200: Temperature (Kelvin) : 103.0", pdb-comment "remark 200: Ph : 7.50", pdb-comment "remark 200: Number Of Crystals Used : 1", pdb-comment "remark 200: Synchrotron (YN) : N", pdb-comment "remark 200: Radiation Source : Rotating Anode", pdb-comment "remark 200: Beamline : Null", pdb-comment "remark 200: X-Ray Generator Model : M18xhf", pdb-comment "remark 200: Monochromatic Or Laue (ML) : M", pdb-comment "remark 200: Wavelength Or Range (A) : 1.5418", pdb-comment "remark 200: Monochromator : Ni Filter", pdb-comment "remark 200: Optics : Mirrors", pdb-comment "remark 200: Detector Type : Image Plate", pdb-comment "remark 200: Detector Manufacturer : Rigaku Raxis Iv", pdb-comment "remark 200: Intensity-Integration Software : Denzo", pdb-comment "remark 200: Data Scaling Software : Scalepack", pdb-comment "remark 200: Number Of Unique Reflections : 118454", pdb-comment "remark 200: Resolution Range High (A) : 2.600", pdb-comment "remark 200: Resolution Range Low (A) : 15.000", pdb-comment "remark 200: Rejection Criteria (Sigma(I)) : 0.000", pdb-comment "remark 200: Overall.", pdb-comment "remark 200: Completeness For Range (%) : 99.6", pdb-comment "remark 200: Data Redundancy : 4.100", pdb-comment "remark 200: R Merge (I) : 0.06400", pdb-comment "remark 200: R Sym (I) : Null", pdb-comment "remark 200: FOR THE DATA SET : 18.7000", pdb-comment "remark 200: In The Highest Resolution Shell.", pdb-comment "remark 200: Highest Resolution Shell, Range High (A) : 2.60", pdb-comment "remark 200: Highest Resolution Shell, Range Low (A) : 2.69", pdb-comment "remark 200: Completeness For Shell (%) : 97.4", pdb-comment "remark 200: Data Redundancy In Shell : 3.80", pdb-comment "remark 200: R Merge For Shell (I) : 0.51900", pdb-comment "remark 200: R Sym For Shell (I) : Null", pdb-comment "remark 200: FOR SHELL : 3.300", pdb-comment "remark 200: Diffraction Protocol: Single Wavelength", pdb-comment "remark 200: Method Used To Determine The Structure: Miras", pdb-comment "remark 200: Software Used: Protein, Mlphare, Dm", pdb-comment "remark 200: Starting Model: Null", pdb-comment "remark 200: Remark: Null", pdb-comment "remark 280: Crystal", pdb-comment "remark 280: Solvent Content, Vs (%): 66.0", pdb-comment "remark 280: Matthews Coefficient, Vm (Angstroms3DA): 3.40", pdb-comment "remark 280: Crystallization Conditions: Protein Was Crystallized From", pdb-comment "remark 280: 2.0 M Ammonium Sulfate, 100 Mm Hepes, Ph 7.5", pdb-comment "remark 290: Crystallographic Symmetry", pdb-comment "remark 290: Symmetry Operators For Space Group: P 21 21 21", pdb-comment "remark 290: Symop Symmetry", pdb-comment "remark 290: Nnnmmm Operator", pdb-comment "remark 290: 1555 X,Y,Z", pdb-comment "remark 290: 2555 12-X,-Y,12+Z", pdb-comment "remark 290: 3555 -X,12+Y,12-Z", pdb-comment "remark 290: 4555 12+X,12-Y,-Z", pdb-comment "remark 290: Where Nnn -> Operator Number", pdb-comment "remark 290: Mmm -> Translation Vector", pdb-comment "remark 290: Crystallographic Symmetry Transformations", pdb-comment "remark 290: The Following Transformations Operate On The AtomHETATM", pdb-comment "remark 290: Records In This Entry To Produce Crystallographically", pdb-comment "remark 290: Related Molecules.", pdb-comment "remark 290: Smtry1 1 1.000000 0.000000 0.000000 0.00000", pdb-comment "remark 290: Smtry2 1 0.000000 1.000000 0.000000 0.00000", pdb-comment "remark 290: Smtry3 1 0.000000 0.000000 1.000000 0.00000", pdb-comment "remark 290: Smtry1 2 -1.000000 0.000000 0.000000 38.69500", pdb-comment "remark 290: Smtry2 2 0.000000 -1.000000 0.000000 0.00000", pdb-comment "remark 290: Smtry3 2 0.000000 0.000000 1.000000 60.14500", pdb-comment "remark 290: Smtry1 3 -1.000000 0.000000 0.000000 0.00000", pdb-comment "remark 290: Smtry2 3 0.000000 1.000000 0.000000 49.86000", pdb-comment "remark 290: Smtry3 3 0.000000 0.000000 -1.000000 60.14500", pdb-comment "remark 290: Smtry1 4 1.000000 0.000000 0.000000 38.69500", pdb-comment "remark 290: Smtry2 4 0.000000 -1.000000 0.000000 49.86000", pdb-comment "remark 290: Smtry3 4 0.000000 0.000000 -1.000000 0.00000", pdb-comment "remark 290: Remark: Null", pdb-comment "remark 465: Missing Residues", pdb-comment "remark 465: The Following Residues Were Not Located In The", pdb-comment "remark 465: Experiment. (Mmodel Number; Resresidue Name; Cchain", pdb-comment "remark 465: Identifier; Ssseqsequence Number; Iinsertion Code.)", pdb-comment "remark 465: M Res C Ssseqi", pdb-comment "remark 465: Ser A 460", pdb-comment "remark 465: Asp A 461", pdb-comment "remark 465: Val A 462", pdb-comment "remark 465: Asp A 463", pdb-comment "remark 465: Asp A 464", pdb-comment "remark 465: Asp A 465", pdb-comment "remark 465: Asp A 466", pdb-comment "remark 470: Missing Atom", pdb-comment "remark 470: The Following Residues Have Missing Atoms(Mmodel Number;", pdb-comment "remark 470: Resresidue Name; Cchain Identifier; Sseqsequence Number;", pdb-comment "remark 470: Iinsertion Code):", pdb-comment "remark 470: M Res Csseqi Atoms", pdb-comment "remark 470: Glu A 38 Cd Oe1 Oe2", pdb-comment "remark 470: Arg A 41 Ne Cz Nh1 Nh2", pdb-comment "remark 470: Tyr A 83 Cg Cd1 Cd2 Ce1 Ce2 Cz Oh", pdb-comment "remark 470: Glu A 157 Cg Cd Oe1 Oe2", pdb-comment "remark 470: Lys A 159 Cd Ce Nz", pdb-comment "remark 470: Asp A 213 Cg Od1 Od2", pdb-comment "remark 470: Glu A 295 Cg Cd Oe1 Oe2", pdb-comment "remark 470: Arg A 336 Cg Cd Ne Cz Nh1 Nh2", pdb-comment "remark 470: His A 406 Cg Nd1 Cd2 Ce1 Ne2", pdb-comment "remark 470: Lys A 412 Cd Ce Nz", pdb-comment "remark 470: Ser A 443 Og", pdb-comment "remark 470: Glu A 459 Cg Cd Oe1 Oe2", pdb-comment "remark 470: Lys A 467 Cg Cd Ce Nz", pdb-comment "remark 470: Glu A 468 Cg Cd Oe1 Oe2", pdb-comment "remark 500: Geometry And Stereochemistry", pdb-comment "remark 500: Subtopic: Close Contacts In Same Asymmetric Unit", pdb-comment "remark 500: The Following Atoms Are In Close Contact.", pdb-comment "remark 500: Atm1 Res C Sseqi Atm2 Res C Sseqi", pdb-comment "remark 500: O2 Fuc A 105b N2 Nag A 105c 2.09", pdb-comment "remark 500: O4 Nag A 105a O5 Nag A 105c 2.17", pdb-comment "remark 500: Geometry And Stereochemistry", pdb-comment "remark 500: Subtopic: Covalent Bond Angles", pdb-comment "remark 500: The Stereochemical Parameters Of The Following Residues", pdb-comment "remark 500: Have Values Which Deviate From Expected Values By More", pdb-comment "remark 500: Than 4Rmsd (Mmodel Number; Resresidue Name; Cchain", pdb-comment "remark 500: Identifier; Sseqsequence Number; Iinsertion Code).", pdb-comment "remark 500: Standard Table:", pdb-comment "remark 500: Format: (10x,I3,1x,A3,1x,A1,I4,A1,3(1x,A4,2x),12x,F5.1)", pdb-comment "remark 500: Expected Values: Engh And Huber, 1991", pdb-comment "remark 500: M Res Csseqi Atm1 Atm2 Atm3", pdb-comment "remark 500: Ile A 9 C - N - Ca Angl. Dev. 15.3 Degrees", pdb-comment "remark 500: Glu A 26 Cg - Cd - Oe2 Angl. Dev. 15.6 Degrees", pdb-comment "remark 500: Arg A 59 Cd - Ne - Cz Angl. Dev. 15.7 Degrees", pdb-comment "remark 500: Glu A 91 Oe1 - Cd - Oe2 Angl. Dev. 16.3 Degrees", pdb-comment "remark 500: Asp A 97 Cb - Cg - Od1 Angl. Dev. 14.8 Degrees", pdb-comment "remark 500: Leu A 131 Ca - Cb - Cg Angl. Dev. 29.9 Degrees", pdb-comment "remark 500: Ser A 279 Ca - Cb - Og Angl. Dev. -14.6 Degrees", pdb-comment "remark 500: Geometry And Stereochemistry", pdb-comment "remark 500: Subtopic: Torsion Angles", pdb-comment "remark 500: Torsion Angles Outside The Expected Ramachandran Regions:", pdb-comment "remark 500: (Mmodel Number; Resresidue Name; Cchain Identifier;", pdb-comment "remark 500: Sseqsequence Number; Iinsertion Code).", pdb-comment "remark 500: Standard Table:", pdb-comment "remark 500: Format:(10x,I3,1x,A3,1x,A1,I4,A1,4x,F7.2,3x,F7.2)", pdb-comment "remark 500: M Res Csseqi Psi Phi", pdb-comment "remark 500: Asn A 11 68.14 -46.64", pdb-comment "remark 999: Sequence", pdb-comment "remark 999: The Polypeptide Consists Of Residues 1-462 Of Igf-1r, An", pdb-comment "remark 999: Enterokinase Cleavage Site And An 11 Residue C-Myc", pdb-comment "remark 999: Purification Tag.", pdb-comment "Dbref 1igr A 1 462 Sws P08069 Ig1r_human 31 492", pdb-comment "Link O6 Nag A 105a C1 Fuc A 105b", pdb-comment "Link O4 Nag A 105a C1 Nag A 105c", pdb-comment "Link O6 Nag A 284a C1 Fuc A 284b", pdb-comment "Link O4 Nag A 284a C1 Nag A 284c", pdb-comment "Link O4 Nag A 284c C1 Man A 284d", pdb-comment "Link O3 Man A 284d C1 Man A 284e", pdb-comment "Link Nd2 Asn A 21 C1 Nag A 21a", pdb-comment "Link Nd2 Asn A 105 C1 Nag A 105a", pdb-comment "Link Nd2 Asn A 214 C1 Nag A 214a", pdb-comment "Link Nd2 Asn A 284 C1 Nag A 284a", pdb-comment "Cispep 1 Gly A 4 Pro A 5 0 -7.97", history { data-source { name-of-database "Protein Data Bank", version-of-database release-date std { year 1999, month 9, day 26 }, database-entry-id other-database { db "PDB", tag str "1IGR" }, database-entry-date std { year 1998, month 9, day 28 } } }, attribution sub { authors { names std { { name name { last "Garrett", full "T.P.J.Garrett", initials "T.P.J." } }, { name name { last "Mckern", full "N.M.Mckern", initials "N.M." } }, { name name { last "Lou", full "M.Lou", initials "M." } }, { name name { last "Frenkel", full "M.J.Frenkel", initials "M.J." } }, { name name { last "Bentley", full "J.D.Bentley", initials "J.D." } }, { name name { last "Lovrecz", full "G.O.Lovrecz", initials "G.O." } }, { name name { last "Elleman", full "T.C.Elleman", initials "T.C." } }, { name name { last "Cosgrove", full "L.J.Cosgrove", initials "L.J." } }, { name name { last "Ward", full "C.W.Ward", initials "C.W." } } } }, imp { date std { year 1998, month 9, day 28 } } }, attribution equiv { article { title { name "Crystal structure of the first three domains of the type-1 insulin-like growth factor receptor." }, authors { names std { { name name { last "Garrett", initials "T.P." } }, { name name { last "McKern", initials "N.M." } }, { name name { last "Lou", initials "M." } }, { name name { last "Frenkel", initials "M.J." } }, { name name { last "Bentley", initials "J.D." } }, { name name { last "Lovrecz", initials "G.O." } }, { name name { last "Elleman", initials "T.C." } }, { name name { last "Cosgrove", initials "L.J." } }, { name name { last "Ward", initials "C.W." } } }, affil str "Biomolecular Research Institute, Parkville, Victoria, Australia. [email protected]" }, from journal { title { iso-jta "Nature", ml-jta "Nature", issn "0028-0836", jta "NSC" }, imp { date std { year 1998, month 7, day 23 }, volume "394", issue "6691", pages "395-399" } } }, muid 98352788 }, attribution equiv { article { title { name "Crystallization of the first three domains of the human insulin-like growth factor-1 receptor." }, authors { names std { { name name { last "Mckern", full "N.M.Mckern", initials "N.M." } }, { name name { last "Lou", full "M.Lou", initials "M." } }, { name name { last "Frenkel", full "M.J.Frenkel", initials "M.J." } }, { name name { last "Verkuylen", full "A.Verkuylen", initials "A." } }, { name name { last "Bentley", full "J.D.Bentley", initials "J.D." } }, { name name { last "Lovrecz", full "G.O.Lovrecz", initials "G.O." } }, { name name { last "Ivancic", full "N.Ivancic", initials "N." } }, { name name { last "Elleman", full "T.C.Elleman", initials "T.C." } }, { name name { last "Garrett", full "T.P.J.Garrett", initials "T.P.J." } }, { name name { last "Cosgrove", full "L.J.Cosgrove", initials "L.J." } }, { name name { last "Ward", full "C.W.Ward", initials "C.W." } } } }, from journal { title { iso-jta "Protein Sci.", ml-jta "Protein Sci", issn "0961-8368", jta "BNW" }, imp { date std { year 1997, month 12 }, volume "6", issue "12", pages "2663-2666" } } }, muid 98078580 } }, chemical-graph { descr { name "Type 1 Insulin-Like Growth Factor Receptor (Domains 1-3)", pdb-class "Hormone Receptor", pdb-source "Mol_id: 1; Organism_scientific: Homo Sapiens; Organism_common: Human; Organ: Placenta; Cellular_location: Cytoplasmic Membrane; Expression_system: Cricetulus Griseus; Expression_system_cell_line: Lec8; Expression_system_collection: Crl:1737; Expression_system_cellular_location: Secreted; Expression_system_plasmid: Pee14IGF-1r462; Other_details: Large Scale Cell Culture In A Cellgen Plus Bioreactor", pdb-comment "Type 1 Insulin-Like Growth Factor Receptor (Domains 1-3) Hormone Receptor, Insulin Receptor Family Mol_id: 1; Molecule: Insulin-Like Growth Factor Receptor 1; Chain: A; Fragment: L1, Cys-Rich, L2; Ec: 2.7.1.112; Engineered: Yes; Biological_unit: Dimer Of Whole Receptor Polypeptides", assembly-type other }, molecule-graphs { { id 1, descr { name "A", pdb-comment "SEQRES", molecule-type protein, organism { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } } }, seq-id gi 6435822, residue-sequence { { id 1, name " 1 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 21 } }, { id 2, name " 2 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 3, name " 3 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 4, name " 4 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 5, name " 5 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 6, name " 6 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 7, name " 7 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 8, name " 8 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 9, name " 9 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 10, name " 10 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 11, name " 11 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 12, name " 12 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 13, name " 13 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 14, name " 14 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 15, name " 15 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 16, name " 16 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 17, name " 17 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 18, name " 18 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 19, name " 19 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 20, name " 20 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 21, name " 21 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 22, name " 22 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 23, name " 23 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 24, name " 24 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 25, name " 25 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 26, name " 26 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 27, name " 27 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 28, name " 28 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 29, name " 29 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 30, name " 30 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 25 } }, { id 31, name " 31 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 32, name " 32 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 33, name " 33 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 34, name " 34 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 35, name " 35 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 36, name " 36 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 37, name " 37 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 38, name " 38 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 39, name " 39 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 40, name " 40 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 41, name " 41 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 42, name " 42 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 43, name " 43 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 44, name " 44 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 45, name " 45 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 46, name " 46 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 47, name " 47 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 48, name " 48 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 49, name " 49 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 50, name " 50 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 51, name " 51 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 52, name " 52 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 53, name " 53 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 54, name " 54 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 55, name " 55 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 56, name " 56 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 57, name " 57 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 58, name " 58 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 59, name " 59 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 60, name " 60 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 61, name " 61 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 62, name " 62 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 63, name " 63 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 64, name " 64 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 65, name " 65 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 66, name " 66 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 67, name " 67 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 68, name " 68 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 69, name " 69 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 70, name " 70 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 71, name " 71 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 72, name " 72 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 73, name " 73 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 74, name " 74 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 75, name " 75 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 76, name " 76 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 77, name " 77 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 78, name " 78 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 79, name " 79 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 52 } }, { id 80, name " 80 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 81, name " 81 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 82, name " 82 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 83, name " 83 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 84, name " 84 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 85, name " 85 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 86, name " 86 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 87, name " 87 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 88, name " 88 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 89, name " 89 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 90, name " 90 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 91, name " 91 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 92, name " 92 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 93, name " 93 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 94, name " 94 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 95, name " 95 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 96, name " 96 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 97, name " 97 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 98, name " 98 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 99, name " 99 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 100, name " 100 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 101, name " 101 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 102, name " 102 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 103, name " 103 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 104, name " 104 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 105, name " 105 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 106, name " 106 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 107, name " 107 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 108, name " 108 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 109, name " 109 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 110, name " 110 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 111, name " 111 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 112, name " 112 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 113, name " 113 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 114, name " 114 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 115, name " 115 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 116, name " 116 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 117, name " 117 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 118, name " 118 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 119, name " 119 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 120, name " 120 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 121, name " 121 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 122, name " 122 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 123, name " 123 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 124, name " 124 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 125, name " 125 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 126, name " 126 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 127, name " 127 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 52 } }, { id 128, name " 128 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 129, name " 129 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 130, name " 130 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 131, name " 131 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 132, name " 132 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 133, name " 133 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 134, name " 134 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 135, name " 135 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 136, name " 136 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 137, name " 137 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 138, name " 138 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 139, name " 139 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 140, name " 140 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 141, name " 141 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 142, name " 142 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 143, name " 143 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 144, name " 144 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 145, name " 145 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 146, name " 146 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 147, name " 147 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 148, name " 148 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 149, name " 149 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 150, name " 150 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 151, name " 151 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 152, name " 152 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 153, name " 153 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 154, name " 154 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 155, name " 155 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 156, name " 156 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 157, name " 157 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 158, name " 158 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 159, name " 159 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 160, name " 160 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 161, name " 161 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 162, name " 162 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 163, name " 163 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 164, name " 164 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 165, name " 165 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 166, name " 166 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 167, name " 167 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 168, name " 168 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 169, name " 169 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 170, name " 170 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 171, name " 171 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 172, name " 172 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 173, name " 173 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 174, name " 174 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 175, name " 175 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 176, name " 176 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 52 } }, { id 177, name " 177 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 178, name " 178 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 179, name " 179 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 180, name " 180 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 181, name " 181 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 182, name " 182 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 183, name " 183 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 184, name " 184 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 185, name " 185 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 186, name " 186 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 187, name " 187 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 188, name " 188 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 189, name " 189 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 190, name " 190 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 191, name " 191 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 192, name " 192 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 193, name " 193 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 194, name " 194 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 195, name " 195 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 196, name " 196 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 197, name " 197 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 198, name " 198 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 199, name " 199 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 200, name " 200 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 201, name " 201 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 202, name " 202 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 25 } }, { id 203, name " 203 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 204, name " 204 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 205, name " 205 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 206, name " 206 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 207, name " 207 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 208, name " 208 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 209, name " 209 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 210, name " 210 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 211, name " 211 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 212, name " 212 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 213, name " 213 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 214, name " 214 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 215, name " 215 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 216, name " 216 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 217, name " 217 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 218, name " 218 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 219, name " 219 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 220, name " 220 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 221, name " 221 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 222, name " 222 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 223, name " 223 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 25 } }, { id 224, name " 224 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 225, name " 225 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 226, name " 226 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 227, name " 227 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 228, name " 228 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 229, name " 229 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 230, name " 230 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 231, name " 231 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 232, name " 232 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 233, name " 233 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 234, name " 234 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 235, name " 235 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 236, name " 236 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 237, name " 237 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 238, name " 238 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 239, name " 239 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 240, name " 240 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 241, name " 241 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 242, name " 242 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 243, name " 243 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 244, name " 244 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 52 } }, { id 245, name " 245 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 246, name " 246 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 247, name " 247 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 248, name " 248 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 249, name " 249 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 250, name " 250 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 251, name " 251 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 252, name " 252 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 253, name " 253 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 254, name " 254 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 255, name " 255 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 256, name " 256 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 257, name " 257 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 258, name " 258 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 259, name " 259 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 260, name " 260 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 261, name " 261 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 262, name " 262 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 263, name " 263 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 264, name " 264 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 265, name " 265 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 266, name " 266 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 267, name " 267 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 268, name " 268 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 269, name " 269 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 25 } }, { id 270, name " 270 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 271, name " 271 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 272, name " 272 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 273, name " 273 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 274, name " 274 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 275, name " 275 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 276, name " 276 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 277, name " 277 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 278, name " 278 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 279, name " 279 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 280, name " 280 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 281, name " 281 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 282, name " 282 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 283, name " 283 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 284, name " 284 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 285, name " 285 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 286, name " 286 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 287, name " 287 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 288, name " 288 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 289, name " 289 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 290, name " 290 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 291, name " 291 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 292, name " 292 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 293, name " 293 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 294, name " 294 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 295, name " 295 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 296, name " 296 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 297, name " 297 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 298, name " 298 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 299, name " 299 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 300, name " 300 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 301, name " 301 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 302, name " 302 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 303, name " 303 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 304, name " 304 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 305, name " 305 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 306, name " 306 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 307, name " 307 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 308, name " 308 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 309, name " 309 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 310, name " 310 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 311, name " 311 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 312, name " 312 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 313, name " 313 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 314, name " 314 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 315, name " 315 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 316, name " 316 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 317, name " 317 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 318, name " 318 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 319, name " 319 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 320, name " 320 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 321, name " 321 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 322, name " 322 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 323, name " 323 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 324, name " 324 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 325, name " 325 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 326, name " 326 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 327, name " 327 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 328, name " 328 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 329, name " 329 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 330, name " 330 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 331, name " 331 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 332, name " 332 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 333, name " 333 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 334, name " 334 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 335, name " 335 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 336, name " 336 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 337, name " 337 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 338, name " 338 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 339, name " 339 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 340, name " 340 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 341, name " 341 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 342, name " 342 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 343, name " 343 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 344, name " 344 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 345, name " 345 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 346, name " 346 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 347, name " 347 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 348, name " 348 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 349, name " 349 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 350, name " 350 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 351, name " 351 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 352, name " 352 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 353, name " 353 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 354, name " 354 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 355, name " 355 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 356, name " 356 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 357, name " 357 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 358, name " 358 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 359, name " 359 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 360, name " 360 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 361, name " 361 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 362, name " 362 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 25 } }, { id 363, name " 363 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 364, name " 364 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 25 } }, { id 365, name " 365 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 366, name " 366 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 367, name " 367 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 368, name " 368 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 369, name " 369 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 370, name " 370 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 371, name " 371 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 372, name " 372 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 373, name " 373 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 374, name " 374 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 375, name " 375 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 376, name " 376 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 377, name " 377 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 378, name " 378 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 379, name " 379 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 380, name " 380 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 381, name " 381 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 382, name " 382 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 383, name " 383 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 384, name " 384 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 385, name " 385 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 386, name " 386 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 387, name " 387 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 388, name " 388 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 389, name " 389 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 390, name " 390 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 391, name " 391 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 392, name " 392 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 393, name " 393 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 394, name " 394 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 395, name " 395 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 396, name " 396 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 397, name " 397 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 398, name " 398 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 399, name " 399 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 400, name " 400 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 401, name " 401 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 402, name " 402 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 52 } }, { id 403, name " 403 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 404, name " 404 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 52 } }, { id 405, name " 405 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 406, name " 406 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 25 } }, { id 407, name " 407 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 408, name " 408 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 409, name " 409 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 410, name " 410 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 411, name " 411 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 412, name " 412 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 413, name " 413 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 414, name " 414 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 415, name " 415 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 416, name " 416 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 417, name " 417 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 418, name " 418 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 419, name " 419 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 420, name " 420 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 40 } }, { id 421, name " 421 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 422, name " 422 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 43 } }, { id 423, name " 423 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 424, name " 424 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 425, name " 425 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 426, name " 426 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 427, name " 427 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 428, name " 428 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 429, name " 429 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 430, name " 430 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 55 } }, { id 431, name " 431 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 432, name " 432 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 37 } }, { id 433, name " 433 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 434, name " 434 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 435, name " 435 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 436, name " 436 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 437, name " 437 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 438, name " 438 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 439, name " 439 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 440, name " 440 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 441, name " 441 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 442, name " 442 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 443, name " 443 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 444, name " 444 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 445, name " 445 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 446, name " 446 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 447, name " 447 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 448, name " 448 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 449, name " 449 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 49 } }, { id 450, name " 450 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 451, name " 451 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 452, name " 452 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 7 } }, { id 453, name " 453 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 22 } }, { id 454, name " 454 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 455, name " 455 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 4 } }, { id 456, name " 456 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 1 } }, { id 457, name " 457 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 458, name " 458 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 13 } }, { id 459, name " 459 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 460, name " ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 461, name " ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 462, name " ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 58 } }, { id 463, name " ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 464, name " ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 465, name " ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 466, name " ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 467, name " 467 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 468, name " 468 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 469, name " 469 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 16 } }, { id 470, name " 470 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 34 } }, { id 471, name " 471 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 472, name " 472 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 28 } }, { id 473, name " 473 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 46 } }, { id 474, name " 474 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 475, name " 475 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 19 } }, { id 476, name " 476 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 10 } }, { id 477, name " 477 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 31 } }, { id 478, name " 478 ", residue-graph standard { biostruc-residue-graph-set-id other-database { db "Standard residue dictionary", tag id 1 }, residue-graph-id 8 } } }, inter-residue-bonds { { atom-id-1 { molecule-id 1, residue-id 1, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 2, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 2, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 3, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 3, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 4, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 4, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 5, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 5, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 6, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 6, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 7, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 7, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 8, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 8, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 9, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 9, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 10, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 10, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 11, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 11, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 12, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 12, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 13, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 13, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 14, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 14, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 15, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 15, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 16, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 16, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 17, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 17, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 18, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 18, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 19, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 19, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 20, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 20, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 21, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 21, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 22, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 22, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 23, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 23, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 24, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 24, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 25, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 25, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 26, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 26, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 27, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 27, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 28, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 28, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 29, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 29, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 30, atom-id 13 } }, { atom-id-1 { molecule-id 1, residue-id 30, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 31, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 31, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 32, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 32, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 33, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 33, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 34, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 34, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 35, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 35, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 36, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 36, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 37, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 37, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 38, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 38, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 39, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 39, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 40, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 40, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 41, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 41, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 42, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 42, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 43, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 43, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 44, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 44, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 45, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 45, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 46, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 46, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 47, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 47, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 48, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 48, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 49, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 49, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 50, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 50, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 51, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 51, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 52, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 52, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 53, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 53, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 54, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 54, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 55, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 55, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 56, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 56, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 57, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 57, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 58, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 58, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 59, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 59, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 60, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 60, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 61, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 61, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 62, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 62, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 63, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 63, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 64, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 64, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 65, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 65, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 66, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 66, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 67, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 67, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 68, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 68, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 69, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 69, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 70, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 70, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 71, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 71, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 72, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 72, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 73, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 73, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 74, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 74, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 75, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 75, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 76, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 76, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 77, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 77, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 78, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 78, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 79, atom-id 20 } }, { atom-id-1 { molecule-id 1, residue-id 79, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 80, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 80, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 81, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 81, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 82, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 82, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 83, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 83, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 84, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 84, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 85, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 85, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 86, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 86, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 87, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 87, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 88, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 88, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 89, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 89, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 90, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 90, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 91, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 91, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 92, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 92, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 93, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 93, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 94, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 94, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 95, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 95, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 96, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 96, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 97, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 97, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 98, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 98, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 99, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 99, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 100, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 100, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 101, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 101, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 102, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 102, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 103, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 103, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 104, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 104, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 105, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 105, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 106, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 106, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 107, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 107, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 108, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 108, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 109, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 109, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 110, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 110, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 111, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 111, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 112, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 112, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 113, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 113, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 114, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 114, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 115, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 115, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 116, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 116, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 117, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 117, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 118, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 118, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 119, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 119, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 120, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 120, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 121, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 121, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 122, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 122, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 123, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 123, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 124, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 124, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 125, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 125, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 126, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 126, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 127, atom-id 20 } }, { atom-id-1 { molecule-id 1, residue-id 127, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 128, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 128, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 129, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 129, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 130, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 130, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 131, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 131, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 132, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 132, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 133, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 133, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 134, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 134, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 135, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 135, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 136, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 136, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 137, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 137, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 138, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 138, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 139, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 139, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 140, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 140, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 141, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 141, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 142, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 142, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 143, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 143, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 144, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 144, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 145, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 145, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 146, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 146, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 147, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 147, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 148, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 148, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 149, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 149, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 150, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 150, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 151, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 151, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 152, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 152, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 153, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 153, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 154, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 154, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 155, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 155, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 156, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 156, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 157, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 157, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 158, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 158, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 159, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 159, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 160, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 160, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 161, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 161, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 162, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 162, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 163, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 163, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 164, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 164, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 165, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 165, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 166, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 166, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 167, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 167, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 168, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 168, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 169, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 169, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 170, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 170, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 171, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 171, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 172, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 172, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 173, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 173, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 174, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 174, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 175, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 175, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 176, atom-id 20 } }, { atom-id-1 { molecule-id 1, residue-id 176, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 177, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 177, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 178, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 178, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 179, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 179, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 180, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 180, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 181, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 181, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 182, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 182, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 183, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 183, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 184, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 184, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 185, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 185, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 186, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 186, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 187, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 187, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 188, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 188, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 189, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 189, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 190, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 190, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 191, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 191, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 192, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 192, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 193, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 193, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 194, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 194, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 195, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 195, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 196, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 196, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 197, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 197, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 198, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 198, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 199, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 199, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 200, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 200, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 201, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 201, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 202, atom-id 13 } }, { atom-id-1 { molecule-id 1, residue-id 202, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 203, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 203, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 204, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 204, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 205, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 205, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 206, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 206, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 207, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 207, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 208, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 208, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 209, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 209, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 210, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 210, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 211, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 211, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 212, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 212, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 213, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 213, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 214, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 214, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 215, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 215, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 216, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 216, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 217, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 217, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 218, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 218, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 219, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 219, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 220, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 220, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 221, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 221, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 222, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 222, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 223, atom-id 13 } }, { atom-id-1 { molecule-id 1, residue-id 223, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 224, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 224, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 225, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 225, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 226, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 226, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 227, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 227, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 228, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 228, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 229, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 229, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 230, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 230, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 231, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 231, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 232, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 232, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 233, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 233, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 234, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 234, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 235, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 235, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 236, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 236, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 237, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 237, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 238, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 238, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 239, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 239, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 240, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 240, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 241, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 241, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 242, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 242, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 243, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 243, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 244, atom-id 20 } }, { atom-id-1 { molecule-id 1, residue-id 244, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 245, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 245, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 246, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 246, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 247, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 247, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 248, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 248, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 249, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 249, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 250, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 250, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 251, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 251, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 252, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 252, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 253, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 253, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 254, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 254, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 255, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 255, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 256, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 256, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 257, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 257, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 258, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 258, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 259, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 259, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 260, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 260, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 261, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 261, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 262, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 262, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 263, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 263, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 264, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 264, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 265, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 265, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 266, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 266, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 267, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 267, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 268, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 268, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 269, atom-id 13 } }, { atom-id-1 { molecule-id 1, residue-id 269, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 270, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 270, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 271, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 271, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 272, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 272, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 273, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 273, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 274, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 274, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 275, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 275, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 276, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 276, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 277, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 277, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 278, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 278, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 279, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 279, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 280, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 280, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 281, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 281, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 282, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 282, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 283, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 283, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 284, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 284, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 285, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 285, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 286, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 286, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 287, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 287, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 288, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 288, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 289, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 289, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 290, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 290, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 291, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 291, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 292, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 292, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 293, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 293, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 294, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 294, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 295, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 295, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 296, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 296, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 297, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 297, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 298, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 298, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 299, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 299, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 300, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 300, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 301, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 301, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 302, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 302, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 303, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 303, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 304, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 304, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 305, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 305, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 306, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 306, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 307, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 307, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 308, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 308, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 309, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 309, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 310, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 310, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 311, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 311, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 312, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 312, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 313, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 313, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 314, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 314, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 315, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 315, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 316, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 316, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 317, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 317, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 318, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 318, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 319, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 319, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 320, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 320, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 321, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 321, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 322, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 322, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 323, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 323, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 324, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 324, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 325, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 325, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 326, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 326, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 327, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 327, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 328, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 328, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 329, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 329, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 330, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 330, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 331, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 331, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 332, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 332, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 333, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 333, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 334, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 334, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 335, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 335, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 336, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 336, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 337, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 337, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 338, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 338, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 339, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 339, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 340, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 340, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 341, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 341, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 342, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 342, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 343, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 343, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 344, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 344, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 345, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 345, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 346, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 346, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 347, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 347, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 348, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 348, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 349, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 349, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 350, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 350, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 351, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 351, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 352, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 352, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 353, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 353, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 354, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 354, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 355, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 355, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 356, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 356, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 357, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 357, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 358, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 358, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 359, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 359, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 360, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 360, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 361, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 361, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 362, atom-id 13 } }, { atom-id-1 { molecule-id 1, residue-id 362, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 363, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 363, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 364, atom-id 13 } }, { atom-id-1 { molecule-id 1, residue-id 364, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 365, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 365, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 366, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 366, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 367, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 367, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 368, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 368, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 369, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 369, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 370, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 370, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 371, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 371, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 372, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 372, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 373, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 373, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 374, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 374, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 375, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 375, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 376, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 376, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 377, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 377, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 378, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 378, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 379, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 379, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 380, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 380, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 381, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 381, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 382, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 382, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 383, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 383, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 384, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 384, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 385, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 385, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 386, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 386, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 387, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 387, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 388, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 388, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 389, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 389, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 390, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 390, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 391, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 391, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 392, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 392, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 393, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 393, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 394, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 394, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 395, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 395, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 396, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 396, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 397, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 397, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 398, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 398, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 399, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 399, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 400, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 400, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 401, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 401, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 402, atom-id 20 } }, { atom-id-1 { molecule-id 1, residue-id 402, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 403, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 403, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 404, atom-id 20 } }, { atom-id-1 { molecule-id 1, residue-id 404, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 405, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 405, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 406, atom-id 13 } }, { atom-id-1 { molecule-id 1, residue-id 406, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 407, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 407, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 408, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 408, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 409, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 409, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 410, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 410, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 411, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 411, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 412, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 412, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 413, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 413, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 414, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 414, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 415, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 415, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 416, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 416, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 417, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 417, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 418, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 418, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 419, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 419, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 420, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 420, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 421, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 421, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 422, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 422, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 423, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 423, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 424, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 424, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 425, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 425, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 426, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 426, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 427, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 427, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 428, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 428, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 429, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 429, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 430, atom-id 17 } }, { atom-id-1 { molecule-id 1, residue-id 430, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 431, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 431, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 432, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 432, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 433, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 433, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 434, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 434, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 435, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 435, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 436, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 436, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 437, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 437, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 438, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 438, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 439, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 439, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 440, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 440, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 441, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 441, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 442, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 442, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 443, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 443, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 444, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 444, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 445, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 445, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 446, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 446, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 447, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 447, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 448, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 448, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 449, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 449, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 450, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 450, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 451, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 451, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 452, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 452, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 453, atom-id 4 } }, { atom-id-1 { molecule-id 1, residue-id 453, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 454, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 454, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 455, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 455, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 456, atom-id 6 } }, { atom-id-1 { molecule-id 1, residue-id 456, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 457, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 457, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 458, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 458, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 459, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 467, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 468, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 468, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 469, atom-id 8 } }, { atom-id-1 { molecule-id 1, residue-id 469, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 470, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 470, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 471, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 471, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 472, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 472, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 473, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 473, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 474, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 474, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 475, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 475, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 476, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 476, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 477, atom-id 10 } }, { atom-id-1 { molecule-id 1, residue-id 477, atom-id 1 }, atom-id-2 { molecule-id 1, residue-id 478, atom-id 7 } }, { atom-id-1 { molecule-id 1, residue-id 3, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 22, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 120, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 148, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 152, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 175, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 162, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 181, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 185, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 194, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 189, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 200, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 201, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 209, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 205, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 218, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 221, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 230, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 234, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 246, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 252, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 273, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 277, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 291, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 294, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 298, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 302, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 323, atom-id 9 } }, { atom-id-1 { molecule-id 1, residue-id 425, atom-id 9 }, atom-id-2 { molecule-id 1, residue-id 458, atom-id 9 } } } }, { id 2, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 21A", residue-graph local 1 } } }, { id 3, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 105A", residue-graph local 1 } } }, { id 4, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 105B", residue-graph local 2 } } }, { id 5, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 105C", residue-graph local 1 } } }, { id 6, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 214A", residue-graph local 1 } } }, { id 7, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 284A", residue-graph local 1 } } }, { id 8, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 284B", residue-graph local 2 } } }, { id 9, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 284C", residue-graph local 1 } } }, { id 10, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 284D", residue-graph local 3 } } }, { id 11, descr { name "1", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 284E", residue-graph local 3 } } }, { id 12, descr { name "2", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 493 ", residue-graph local 4 } } }, { id 13, descr { name "2", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 494 ", residue-graph local 4 } } }, { id 14, descr { name "2", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 495 ", residue-graph local 4 } } }, { id 15, descr { name "2", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 496 ", residue-graph local 4 } } }, { id 16, descr { name "2", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 497 ", residue-graph local 4 } } }, { id 17, descr { name "2", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 498 ", residue-graph local 4 } } }, { id 18, descr { name "2", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 499 ", residue-graph local 4 } } }, { id 19, descr { name "2", molecule-type other-nonpolymer }, residue-sequence { { id 1, name " 500 ", residue-graph local 4 } } }, { id 20, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 501 ", residue-graph local 5 } } }, { id 21, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 502 ", residue-graph local 5 } } }, { id 22, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 503 ", residue-graph local 5 } } }, { id 23, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 504 ", residue-graph local 5 } } }, { id 24, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 505 ", residue-graph local 5 } } }, { id 25, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 506 ", residue-graph local 5 } } }, { id 26, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 507 ", residue-graph local 5 } } }, { id 27, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 508 ", residue-graph local 5 } } }, { id 28, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 509 ", residue-graph local 5 } } }, { id 29, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 510 ", residue-graph local 5 } } }, { id 30, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 511 ", residue-graph local 5 } } }, { id 31, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 512 ", residue-graph local 5 } } }, { id 32, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 513 ", residue-graph local 5 } } }, { id 33, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 514 ", residue-graph local 5 } } }, { id 34, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 515 ", residue-graph local 5 } } }, { id 35, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 516 ", residue-graph local 5 } } }, { id 36, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 517 ", residue-graph local 5 } } }, { id 37, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 518 ", residue-graph local 5 } } }, { id 38, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 519 ", residue-graph local 5 } } }, { id 39, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 520 ", residue-graph local 5 } } }, { id 40, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 521 ", residue-graph local 5 } } }, { id 41, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 522 ", residue-graph local 5 } } }, { id 42, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 523 ", residue-graph local 5 } } }, { id 43, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 524 ", residue-graph local 5 } } }, { id 44, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 525 ", residue-graph local 5 } } }, { id 45, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 526 ", residue-graph local 5 } } }, { id 46, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 527 ", residue-graph local 5 } } }, { id 47, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 528 ", residue-graph local 5 } } }, { id 48, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 529 ", residue-graph local 5 } } }, { id 49, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 530 ", residue-graph local 5 } } }, { id 50, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 531 ", residue-graph local 5 } } }, { id 51, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 532 ", residue-graph local 5 } } }, { id 52, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 533 ", residue-graph local 5 } } }, { id 53, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 534 ", residue-graph local 5 } } }, { id 54, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 535 ", residue-graph local 5 } } }, { id 55, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 536 ", residue-graph local 5 } } }, { id 56, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 537 ", residue-graph local 5 } } }, { id 57, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 538 ", residue-graph local 5 } } }, { id 58, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 539 ", residue-graph local 5 } } }, { id 59, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 540 ", residue-graph local 5 } } }, { id 60, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 541 ", residue-graph local 5 } } }, { id 61, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 542 ", residue-graph local 5 } } }, { id 62, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 543 ", residue-graph local 5 } } }, { id 63, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 544 ", residue-graph local 5 } } }, { id 64, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 545 ", residue-graph local 5 } } }, { id 65, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 546 ", residue-graph local 5 } } }, { id 66, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 547 ", residue-graph local 5 } } }, { id 67, descr { name "2", molecule-type solvent }, residue-sequence { { id 1, name " 548 ", residue-graph local 5 } } } }, inter-molecule-bonds { { atom-id-1 { molecule-id 3, residue-id 1, atom-id 11 }, atom-id-2 { molecule-id 5, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 3, residue-id 1, atom-id 13 }, atom-id-2 { molecule-id 4, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 7, residue-id 1, atom-id 11 }, atom-id-2 { molecule-id 9, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 7, residue-id 1, atom-id 13 }, atom-id-2 { molecule-id 8, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 9, residue-id 1, atom-id 11 }, atom-id-2 { molecule-id 10, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 10, residue-id 1, atom-id 8 }, atom-id-2 { molecule-id 11, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 1, residue-id 21, atom-id 8 }, atom-id-2 { molecule-id 2, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 1, residue-id 105, atom-id 8 }, atom-id-2 { molecule-id 3, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 1, residue-id 214, atom-id 8 }, atom-id-2 { molecule-id 6, residue-id 1, atom-id 1 } }, { atom-id-1 { molecule-id 1, residue-id 284, atom-id 8 }, atom-id-2 { molecule-id 7, residue-id 1, atom-id 1 } } }, residue-graphs { { id 1, descr { name "NAG", pdb-comment "" }, residue-type other, iupac-code { "X" }, atoms { { id 1, name " C1 ", iupac-code { " C1 " }, element c }, { id 2, name " C2 ", iupac-code { " C2 " }, element c }, { id 3, name " C3 ", iupac-code { " C3 " }, element c }, { id 4, name " C4 ", iupac-code { " C4 " }, element c }, { id 5, name " C5 ", iupac-code { " C5 " }, element c }, { id 6, name " C6 ", iupac-code { " C6 " }, element c }, { id 7, name " C7 ", iupac-code { " C7 " }, element c }, { id 8, name " C8 ", iupac-code { " C8 " }, element c }, { id 9, name " N2 ", iupac-code { " N2 " }, element n }, { id 10, name " O3 ", iupac-code { " O3 " }, element o }, { id 11, name " O4 ", iupac-code { " O4 " }, element o }, { id 12, name " O5 ", iupac-code { " O5 " }, element o }, { id 13, name " O6 ", iupac-code { " O6 " }, element o }, { id 14, name " O7 ", iupac-code { " O7 " }, element o } }, bonds { { atom-id-1 1, atom-id-2 2, bond-order unknown }, { atom-id-1 1, atom-id-2 12, bond-order unknown }, { atom-id-1 2, atom-id-2 3, bond-order unknown }, { atom-id-1 2, atom-id-2 9, bond-order unknown }, { atom-id-1 3, atom-id-2 4, bond-order unknown }, { atom-id-1 3, atom-id-2 10, bond-order unknown }, { atom-id-1 4, atom-id-2 5, bond-order unknown }, { atom-id-1 4, atom-id-2 11, bond-order unknown }, { atom-id-1 5, atom-id-2 6, bond-order unknown }, { atom-id-1 5, atom-id-2 12, bond-order unknown }, { atom-id-1 6, atom-id-2 13, bond-order unknown }, { atom-id-1 7, atom-id-2 8, bond-order unknown }, { atom-id-1 7, atom-id-2 9, bond-order unknown }, { atom-id-1 7, atom-id-2 14, bond-order unknown } } }, { id 2, descr { name "FUC", pdb-comment "" }, residue-type other, iupac-code { "X" }, atoms { { id 1, name " C1 ", iupac-code { " C1 " }, element c }, { id 2, name " C2 ", iupac-code { " C2 " }, element c }, { id 3, name " C3 ", iupac-code { " C3 " }, element c }, { id 4, name " C4 ", iupac-code { " C4 " }, element c }, { id 5, name " C5 ", iupac-code { " C5 " }, element c }, { id 6, name " C6 ", iupac-code { " C6 " }, element c }, { id 7, name " O2 ", iupac-code { " O2 " }, element o }, { id 8, name " O3 ", iupac-code { " O3 " }, element o }, { id 9, name " O4 ", iupac-code { " O4 " }, element o }, { id 10, name " O5 ", iupac-code { " O5 " }, element o } }, bonds { { atom-id-1 1, atom-id-2 2, bond-order unknown }, { atom-id-1 1, atom-id-2 10, bond-order unknown }, { atom-id-1 2, atom-id-2 3, bond-order unknown }, { atom-id-1 2, atom-id-2 7, bond-order unknown }, { atom-id-1 3, atom-id-2 4, bond-order unknown }, { atom-id-1 3, atom-id-2 8, bond-order unknown }, { atom-id-1 4, atom-id-2 5, bond-order unknown }, { atom-id-1 4, atom-id-2 9, bond-order unknown }, { atom-id-1 5, atom-id-2 6, bond-order unknown }, { atom-id-1 5, atom-id-2 10, bond-order unknown } } }, { id 3, descr { name "MAN", pdb-comment "" }, residue-type other, iupac-code { "X" }, atoms { { id 1, name " C1 ", iupac-code { " C1 " }, element c }, { id 2, name " C2 ", iupac-code { " C2 " }, element c }, { id 3, name " C3 ", iupac-code { " C3 " }, element c }, { id 4, name " C4 ", iupac-code { " C4 " }, element c }, { id 5, name " C5 ", iupac-code { " C5 " }, element c }, { id 6, name " C6 ", iupac-code { " C6 " }, element c }, { id 7, name " O2 ", iupac-code { " O2 " }, element o }, { id 8, name " O3 ", iupac-code { " O3 " }, element o }, { id 9, name " O4 ", iupac-code { " O4 " }, element o }, { id 10, name " O5 ", iupac-code { " O5 " }, element o }, { id 11, name " O6 ", iupac-code { " O6 " }, element o } }, bonds { { atom-id-1 1, atom-id-2 2, bond-order unknown }, { atom-id-1 1, atom-id-2 10, bond-order unknown }, { atom-id-1 2, atom-id-2 3, bond-order unknown }, { atom-id-1 2, atom-id-2 7, bond-order unknown }, { atom-id-1 3, atom-id-2 4, bond-order unknown }, { atom-id-1 3, atom-id-2 8, bond-order unknown }, { atom-id-1 4, atom-id-2 5, bond-order unknown }, { atom-id-1 4, atom-id-2 9, bond-order unknown }, { atom-id-1 5, atom-id-2 6, bond-order unknown }, { atom-id-1 5, atom-id-2 10, bond-order unknown }, { atom-id-1 6, atom-id-2 11, bond-order unknown } } }, { id 4, descr { name "SO4", pdb-comment "" }, residue-type other, iupac-code { "X" }, atoms { { id 1, name " S ", iupac-code { " S " }, element s }, { id 2, name " O1 ", iupac-code { " O1 " }, element o }, { id 3, name " O2 ", iupac-code { " O2 " }, element o }, { id 4, name " O3 ", iupac-code { " O3 " }, element o }, { id 5, name " O4 ", iupac-code { " O4 " }, element o } }, bonds { { atom-id-1 1, atom-id-2 2, bond-order unknown }, { atom-id-1 1, atom-id-2 3, bond-order unknown }, { atom-id-1 1, atom-id-2 4, bond-order unknown }, { atom-id-1 1, atom-id-2 5, bond-order unknown } } }, { id 5, descr { name "HOH", pdb-comment "" }, residue-type other, iupac-code { "X" }, atoms { { id 1, name " O ", iupac-code { " O " }, element o } }, bonds { } } } }, features { { id 1, descr { name "PDB secondary structure" }, features { { id 1, name " 1", type helix, location subgraph residues interval { { molecule-id 1, from 12, to 20 } } }, { id 2, name " 2", type helix, location subgraph residues interval { { molecule-id 1, from 65, to 69 } } }, { id 3, name " 3", type helix, location subgraph residues interval { { molecule-id 1, from 126, to 131 } } }, { id 4, name " 4", type helix, location subgraph residues interval { { molecule-id 1, from 133, to 137 } } }, { id 5, name " 5", type helix, location subgraph residues interval { { molecule-id 1, from 144, to 149 } } }, { id 6, name " 6", type helix, location subgraph residues interval { { molecule-id 1, from 186, to 190 } } }, { id 7, name " 7", type helix, location subgraph residues interval { { molecule-id 1, from 248, to 254 } } }, { id 8, name " 8", type helix, location subgraph residues interval { { molecule-id 1, from 314, to 318 } } }, { id 9, name " 9", type helix, location subgraph residues interval { { molecule-id 1, from 344, to 349 } } }, { id 10, name " 10", type helix, location subgraph residues interval { { molecule-id 1, from 425, to 437 } } }, { id 11, name " 11", type helix, location subgraph residues interval { { molecule-id 1, from 473, to 478 } } }, { id 12, name " A 1", type strand, location subgraph residues interval { { molecule-id 1, from 2, to 3 } } }, { id 13, name " A 2", type strand, location subgraph residues interval { { molecule-id 1, from 24, to 25 } } }, { id 14, name " A 3", type strand, location subgraph residues interval { { molecule-id 1, from 50, to 51 } } }, { id 15, name " A 4", type strand, location subgraph residues interval { { molecule-id 1, from 75, to 76 } } }, { id 16, name " A 5", type strand, location subgraph residues interval { { molecule-id 1, from 105, to 106 } } }, { id 17, name " B 1", type strand, location subgraph residues interval { { molecule-id 1, from 7, to 10 } } }, { id 18, name " B 2", type strand, location subgraph residues interval { { molecule-id 1, from 29, to 35 } } }, { id 19, name " B 3", type strand, location subgraph residues interval { { molecule-id 1, from 55, to 61 } } }, { id 20, name " B 4", type strand, location subgraph residues interval { { molecule-id 1, from 85, to 90 } } }, { id 21, name " B 5", type strand, location subgraph residues interval { { molecule-id 1, from 110, to 114 } } }, { id 22, name " B 6", type strand, location subgraph residues interval { { molecule-id 1, from 138, to 140 } } }, { id 23, name " C 1", type strand, location subgraph residues interval { { molecule-id 1, from 164, to 166 } } }, { id 24, name " C 2", type strand, location subgraph residues interval { { molecule-id 1, from 171, to 173 } } }, { id 25, name " D 1", type strand, location subgraph residues interval { { molecule-id 1, from 205, to 209 } } }, { id 26, name " D 2", type strand, location subgraph residues interval { { molecule-id 1, from 218, to 221 } } }, { id 27, name " E 1", type strand, location subgraph residues interval { { molecule-id 1, from 224, to 225 } } }, { id 28, name " E 2", type strand, location subgraph residues interval { { molecule-id 1, from 230, to 231 } } }, { id 29, name " F 1", type strand, location subgraph residues interval { { molecule-id 1, from 239, to 241 } } }, { id 30, name " F 2", type strand, location subgraph residues interval { { molecule-id 1, from 245, to 247 } } }, { id 31, name " G 1", type strand, location subgraph residues interval { { molecule-id 1, from 267, to 269 } } }, { id 32, name " G 2", type strand, location subgraph residues interval { { molecule-id 1, from 272, to 274 } } }, { id 33, name " H 1", type strand, location subgraph residues interval { { molecule-id 1, from 281, to 283 } } }, { id 34, name " H 2", type strand, location subgraph residues interval { { molecule-id 1, from 291, to 293 } } }, { id 35, name " I 1", type strand, location subgraph residues interval { { molecule-id 1, from 301, to 311 } } }, { id 36, name " I 2", type strand, location subgraph residues interval { { molecule-id 1, from 325, to 332 } } }, { id 37, name " I 3", type strand, location subgraph residues interval { { molecule-id 1, from 353, to 354 } } }, { id 38, name " I 4", type strand, location subgraph residues interval { { molecule-id 1, from 377, to 378 } } }, { id 39, name " I 5", type strand, location subgraph residues interval { { molecule-id 1, from 410, to 411 } } }, { id 40, name " I1 3", type strand, location subgraph residues interval { { molecule-id 1, from 358, to 361 } } }, { id 41, name " I1 4", type strand, location subgraph residues interval { { molecule-id 1, from 388, to 393 } } }, { id 42, name " I1 5", type strand, location subgraph residues interval { { molecule-id 1, from 415, to 419 } } } } }, { id 2, descr { name "NCBI assigned secondary structure" }, features { { id 1, name "helix 1", type helix, location subgraph residues interval { { molecule-id 1, from 248, to 255 } } }, { id 2, name "helix 2", type helix, location subgraph residues interval { { molecule-id 1, from 340, to 348 } } }, { id 3, name "helix 3", type helix, location subgraph residues interval { { molecule-id 1, from 427, to 436 } } }, { id 4, name "strand 1", type strand, location subgraph residues interval { { molecule-id 1, from 1, to 4 } } }, { id 5, name "strand 2", type strand, location subgraph residues interval { { molecule-id 1, from 5, to 11 } } }, { id 6, name "strand 3", type strand, location subgraph residues interval { { molecule-id 1, from 23, to 26 } } }, { id 7, name "strand 4", type strand, location subgraph residues interval { { molecule-id 1, from 27, to 32 } } }, { id 8, name "strand 5", type strand, location subgraph residues interval { { molecule-id 1, from 33, to 36 } } }, { id 9, name "strand 6", type strand, location subgraph residues interval { { molecule-id 1, from 49, to 52 } } }, { id 10, name "strand 7", type strand, location subgraph residues interval { { molecule-id 1, from 53, to 59 } } }, { id 11, name "strand 8", type strand, location subgraph residues interval { { molecule-id 1, from 64, to 67 } } }, { id 12, name "strand 9", type strand, location subgraph residues interval { { molecule-id 1, from 74, to 78 } } }, { id 13, name "strand 10", type strand, location subgraph residues interval { { molecule-id 1, from 86, to 94 } } }, { id 14, name "strand 11", type strand, location subgraph residues interval { { molecule-id 1, from 96, to 99 } } }, { id 15, name "strand 12", type strand, location subgraph residues interval { { molecule-id 1, from 104, to 108 } } }, { id 16, name "strand 13", type strand, location subgraph residues interval { { molecule-id 1, from 110, to 117 } } }, { id 17, name "strand 14", type strand, location subgraph residues interval { { molecule-id 1, from 136, to 143 } } }, { id 18, name "strand 15", type strand, location subgraph residues interval { { molecule-id 1, from 153, to 156 } } }, { id 19, name "strand 16", type strand, location subgraph residues interval { { molecule-id 1, from 158, to 161 } } }, { id 20, name "strand 17", type strand, location subgraph residues interval { { molecule-id 1, from 163, to 168 } } }, { id 21, name "strand 18", type strand, location subgraph residues interval { { molecule-id 1, from 169, to 177 } } }, { id 22, name "strand 19", type strand, location subgraph residues interval { { molecule-id 1, from 179, to 182 } } }, { id 23, name "strand 20", type strand, location subgraph residues interval { { molecule-id 1, from 223, to 227 } } }, { id 24, name "strand 21", type strand, location subgraph residues interval { { molecule-id 1, from 228, to 232 } } }, { id 25, name "strand 22", type strand, location subgraph residues interval { { molecule-id 1, from 239, to 242 } } }, { id 26, name "strand 23", type strand, location subgraph residues interval { { molecule-id 1, from 243, to 247 } } }, { id 27, name "strand 24", type strand, location subgraph residues interval { { molecule-id 1, from 266, to 270 } } }, { id 28, name "strand 25", type strand, location subgraph residues interval { { molecule-id 1, from 271, to 275 } } }, { id 29, name "strand 26", type strand, location subgraph residues interval { { molecule-id 1, from 280, to 284 } } }, { id 30, name "strand 27", type strand, location subgraph residues interval { { molecule-id 1, from 290, to 294 } } }, { id 31, name "strand 28", type strand, location subgraph residues interval { { molecule-id 1, from 300, to 303 } } }, { id 32, name "strand 29", type strand, location subgraph residues interval { { molecule-id 1, from 307, to 313 } } }, { id 33, name "strand 30", type strand, location subgraph residues interval { { molecule-id 1, from 324, to 327 } } }, { id 34, name "strand 31", type strand, location subgraph residues interval { { molecule-id 1, from 328, to 336 } } }, { id 35, name "strand 32", type strand, location subgraph residues interval { { molecule-id 1, from 352, to 355 } } }, { id 36, name "strand 33", type strand, location subgraph residues interval { { molecule-id 1, from 356, to 362 } } }, { id 37, name "strand 34", type strand, location subgraph residues interval { { molecule-id 1, from 367, to 370 } } }, { id 38, name "strand 35", type strand, location subgraph residues interval { { molecule-id 1, from 376, to 380 } } }, { id 39, name "strand 36", type strand, location subgraph residues interval { { molecule-id 1, from 389, to 397 } } }, { id 40, name "strand 37", type strand, location subgraph residues interval { { molecule-id 1, from 399, to 402 } } }, { id 41, name "strand 38", type strand, location subgraph residues interval { { molecule-id 1, from 409, to 413 } } }, { id 42, name "strand 39", type strand, location subgraph residues interval { { molecule-id 1, from 415, to 420 } } } } }, { id 3, descr { name "NCBI Domains" }, features { { id 1, name "Domain", type subgraph, location subgraph residues interval { { molecule-id 1, from 1, to 148 } } }, { id 2, name "Domain", type subgraph, location subgraph residues interval { { molecule-id 1, from 149, to 202 } } }, { id 3, name "Domain", type subgraph, location subgraph residues interval { { molecule-id 1, from 203, to 297 } } }, { id 4, name "Domain", type subgraph, location subgraph residues interval { { molecule-id 1, from 298, to 478 } } } } } }, model { { id 3, type ncbi-all-atom, descr { name "Single-coordinate-per-atom model from PDB entry 1IGR with a vector model attached", pdb-reso "Resolution: 2.6", pdb-method "X-Ray Diffraction", pdb-comment "SEP 27 99 Initial Entry" }, model-space { coordinate-units angstroms, thermal-factor-units b, occupancy-factor-units fractional }, model-coordinates { { id 1, coordinates literal atomic { number-of-points 3900, atoms { number-of-ptrs 3900, molecule-ids { 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 9, 9, 9, 9, 9, 9, 9, 9, 9, 9, 9, 9, 9, 9, 10, 10, 10, 10, 10, 10, 10, 10, 10, 10, 10, 11, 11, 11, 11, 11, 11, 11, 11, 11, 11, 11, 12, 12, 12, 12, 12, 13, 13, 13, 13, 13, 14, 14, 14, 14, 14, 15, 15, 15, 15, 15, 16, 16, 16, 16, 16, 17, 17, 17, 17, 17, 18, 18, 18, 18, 18, 19, 19, 19, 19, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67 }, residue-ids { 1, 1, 1, 1, 1, 1, 1, 1, 1, 2, 2, 2, 2, 2, 2, 2, 2, 3, 3, 3, 3, 3, 3, 4, 4, 4, 4, 5, 5, 5, 5, 5, 5, 5, 6, 6, 6, 6, 7, 7, 7, 7, 7, 7, 7, 7, 8, 8, 8, 8, 8, 8, 8, 8, 9, 9, 9, 9, 9, 9, 9, 9, 10, 10, 10, 10, 10, 10, 10, 10, 10, 10, 10, 11, 11, 11, 11, 11, 11, 11, 11, 12, 12, 12, 12, 12, 12, 12, 12, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 13, 14, 14, 14, 14, 14, 14, 14, 14, 14, 15, 15, 15, 15, 15, 15, 15, 15, 15, 16, 16, 16, 16, 16, 16, 16, 16, 17, 17, 17, 17, 17, 17, 17, 17, 17, 18, 18, 18, 18, 18, 18, 18, 18, 18, 18, 18, 19, 19, 19, 19, 19, 19, 19, 19, 20, 20, 20, 20, 20, 20, 20, 20, 20, 21, 21, 21, 21, 21, 21, 21, 21, 22, 22, 22, 22, 22, 22, 23, 23, 23, 23, 23, 23, 23, 24, 24, 24, 24, 24, 24, 24, 25, 25, 25, 25, 25, 25, 25, 25, 26, 26, 26, 26, 26, 26, 26, 26, 26, 27, 27, 27, 27, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 28, 29, 29, 29, 29, 29, 29, 29, 29, 30, 30, 30, 30, 30, 30, 30, 30, 30, 30, 31, 31, 31, 31, 31, 31, 31, 31, 32, 32, 32, 32, 32, 32, 32, 32, 33, 33, 33, 33, 33, 33, 33, 33, 34, 34, 34, 34, 34, 34, 34, 34, 35, 35, 35, 35, 35, 35, 36, 36, 36, 36, 36, 36, 36, 36, 36, 37, 37, 37, 37, 37, 38, 38, 38, 38, 38, 38, 39, 39, 39, 39, 39, 39, 39, 39, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 41, 41, 41, 41, 41, 41, 41, 42, 42, 42, 42, 42, 42, 43, 43, 43, 43, 43, 43, 43, 43, 43, 43, 43, 43, 44, 44, 44, 44, 44, 44, 44, 44, 44, 44, 44, 45, 45, 45, 45, 45, 45, 45, 45, 45, 45, 45, 46, 46, 46, 46, 46, 46, 46, 47, 47, 47, 47, 47, 47, 47, 47, 47, 48, 48, 48, 48, 48, 48, 48, 48, 49, 49, 49, 49, 49, 49, 49, 50, 50, 50, 50, 50, 50, 50, 51, 51, 51, 51, 51, 51, 51, 51, 52, 52, 52, 52, 52, 52, 52, 53, 53, 53, 53, 53, 53, 53, 53, 53, 54, 54, 54, 54, 54, 54, 54, 54, 54, 54, 54, 54, 55, 55, 55, 55, 55, 55, 55, 55, 56, 56, 56, 56, 56, 56, 56, 56, 57, 57, 57, 57, 57, 57, 57, 57, 58, 58, 58, 58, 58, 58, 58, 58, 58, 58, 58, 59, 59, 59, 59, 59, 59, 59, 59, 59, 59, 59, 60, 60, 60, 60, 60, 60, 60, 61, 61, 61, 61, 61, 62, 62, 62, 62, 63, 63, 63, 63, 63, 63, 63, 63, 64, 64, 64, 64, 64, 64, 64, 64, 64, 65, 65, 65, 65, 65, 65, 66, 66, 66, 66, 66, 66, 66, 66, 67, 67, 67, 67, 68, 68, 68, 68, 68, 68, 68, 68, 69, 69, 69, 69, 69, 69, 69, 69, 70, 70, 70, 70, 70, 70, 70, 70, 70, 70, 70, 71, 71, 71, 71, 71, 71, 71, 72, 72, 72, 72, 72, 72, 72, 72, 73, 73, 73, 73, 73, 73, 73, 73, 74, 74, 74, 74, 74, 74, 74, 75, 75, 75, 75, 75, 75, 75, 76, 76, 76, 76, 76, 76, 76, 76, 77, 77, 77, 77, 77, 77, 77, 77, 77, 77, 77, 78, 78, 78, 78, 79, 79, 79, 79, 79, 79, 79, 79, 79, 79, 79, 79, 79, 79, 80, 80, 80, 80, 80, 80, 80, 80, 80, 81, 81, 81, 81, 81, 81, 81, 81, 82, 82, 82, 82, 82, 82, 82, 82, 82, 82, 82, 83, 83, 83, 83, 83, 84, 84, 84, 84, 84, 84, 84, 84, 85, 85, 85, 85, 85, 85, 85, 85, 85, 85, 85, 85, 86, 86, 86, 86, 86, 87, 87, 87, 87, 87, 87, 87, 87, 88, 88, 88, 88, 88, 88, 88, 89, 89, 89, 89, 89, 89, 89, 89, 90, 90, 90, 90, 90, 90, 90, 90, 90, 90, 90, 91, 91, 91, 91, 91, 91, 91, 91, 91, 92, 92, 92, 92, 92, 92, 92, 92, 93, 93, 93, 93, 93, 93, 93, 94, 94, 94, 94, 94, 94, 94, 94, 95, 95, 95, 95, 95, 95, 95, 95, 96, 96, 96, 96, 96, 96, 96, 96, 96, 97, 97, 97, 97, 97, 97, 97, 97, 98, 98, 98, 98, 98, 98, 98, 98, 99, 99, 99, 99, 100, 100, 100, 100, 100, 100, 100, 100, 101, 101, 101, 101, 101, 101, 101, 101, 101, 101, 101, 101, 102, 102, 102, 102, 102, 102, 102, 102, 103, 103, 103, 103, 103, 103, 103, 103, 104, 104, 104, 104, 104, 104, 104, 104, 104, 104, 104, 105, 105, 105, 105, 105, 105, 105, 105, 106, 106, 106, 106, 106, 106, 106, 106, 107, 107, 107, 107, 107, 107, 107, 108, 108, 108, 108, 108, 108, 108, 108, 108, 108, 108, 109, 109, 109, 109, 110, 110, 110, 110, 110, 111, 111, 111, 111, 111, 111, 111, 111, 112, 112, 112, 112, 112, 112, 112, 112, 112, 112, 112, 113, 113, 113, 113, 113, 113, 113, 113, 114, 114, 114, 114, 114, 114, 114, 114, 114, 115, 115, 115, 115, 115, 115, 115, 115, 115, 116, 116, 116, 116, 116, 116, 116, 116, 117, 117, 117, 117, 117, 118, 118, 118, 118, 118, 118, 118, 118, 119, 119, 119, 119, 119, 119, 119, 119, 120, 120, 120, 120, 120, 120, 121, 121, 121, 121, 121, 121, 121, 121, 121, 121, 121, 121, 122, 122, 122, 122, 122, 122, 122, 122, 123, 123, 123, 123, 123, 123, 124, 124, 124, 124, 124, 124, 124, 125, 125, 125, 125, 125, 125, 125, 126, 126, 126, 126, 126, 126, 126, 126, 127, 127, 127, 127, 127, 127, 127, 127, 127, 127, 127, 127, 127, 127, 128, 128, 128, 128, 128, 128, 129, 129, 129, 129, 129, 129, 129, 129, 130, 130, 130, 130, 130, 130, 130, 130, 131, 131, 131, 131, 131, 131, 131, 131, 132, 132, 132, 132, 132, 132, 132, 132, 133, 133, 133, 133, 133, 134, 134, 134, 134, 134, 134, 134, 135, 135, 135, 135, 135, 135, 136, 136, 136, 136, 136, 136, 136, 136, 137, 137, 137, 137, 137, 137, 137, 137, 138, 138, 138, 138, 138, 138, 138, 138, 138, 138, 138, 138, 139, 139, 139, 139, 139, 139, 139, 139, 140, 140, 140, 140, 140, 140, 140, 141, 141, 141, 141, 142, 142, 142, 142, 142, 142, 142, 142, 143, 143, 143, 143, 143, 143, 143, 143, 143, 144, 144, 144, 144, 144, 144, 144, 145, 145, 145, 145, 145, 145, 145, 146, 146, 146, 146, 146, 146, 146, 146, 146, 147, 147, 147, 147, 147, 147, 147, 147, 147, 148, 148, 148, 148, 148, 148, 149, 149, 149, 149, 150, 150, 150, 150, 150, 150, 150, 150, 151, 151, 151, 151, 151, 151, 151, 151, 152, 152, 152, 152, 152, 152, 153, 153, 153, 153, 153, 153, 153, 154, 154, 154, 154, 155, 155, 155, 155, 155, 155, 155, 156, 156, 156, 156, 156, 156, 156, 156, 157, 157, 157, 157, 157, 158, 158, 158, 158, 158, 158, 158, 158, 158, 159, 159, 159, 159, 159, 159, 160, 160, 160, 160, 160, 160, 160, 161, 161, 161, 161, 161, 161, 161, 161, 162, 162, 162, 162, 162, 162, 163, 163, 163, 163, 163, 163, 163, 163, 163, 164, 164, 164, 164, 164, 164, 164, 164, 164, 165, 165, 165, 165, 165, 165, 165, 166, 166, 166, 166, 166, 166, 166, 167, 167, 167, 167, 167, 167, 167, 167, 168, 168, 168, 168, 168, 168, 168, 168, 169, 169, 169, 169, 169, 169, 169, 169, 170, 170, 170, 170, 170, 170, 170, 170, 170, 171, 171, 171, 171, 171, 171, 171, 171, 171, 171, 171, 171, 172, 172, 172, 172, 172, 172, 172, 172, 173, 173, 173, 173, 173, 173, 173, 173, 173, 173, 173, 173, 174, 174, 174, 174, 174, 174, 174, 174, 174, 174, 174, 175, 175, 175, 175, 175, 175, 176, 176, 176, 176, 176, 176, 176, 176, 176, 176, 176, 176, 176, 176, 177, 177, 177, 177, 177, 177, 177, 178, 178, 178, 178, 178, 178, 178, 179, 179, 179, 179, 179, 179, 179, 179, 180, 180, 180, 180, 180, 180, 180, 180, 180, 180, 180, 181, 181, 181, 181, 181, 181, 182, 182, 182, 182, 182, 182, 182, 182, 182, 183, 183, 183, 183, 183, 183, 183, 183, 183, 184, 184, 184, 184, 184, 184, 184, 184, 185, 185, 185, 185, 185, 185, 186, 186, 186, 186, 186, 186, 186, 187, 187, 187, 187, 187, 187, 188, 188, 188, 188, 188, 188, 188, 189, 189, 189, 189, 189, 189, 190, 190, 190, 190, 191, 191, 191, 191, 191, 191, 191, 191, 191, 192, 192, 192, 192, 192, 192, 192, 192, 192, 192, 192, 193, 193, 193, 193, 193, 194, 194, 194, 194, 194, 194, 195, 195, 195, 195, 195, 195, 195, 196, 196, 196, 196, 196, 196, 196, 196, 196, 197, 197, 197, 197, 197, 197, 197, 197, 198, 198, 198, 198, 198, 198, 198, 198, 199, 199, 199, 199, 199, 199, 199, 199, 199, 200, 200, 200, 200, 200, 200, 201, 201, 201, 201, 201, 201, 202, 202, 202, 202, 202, 202, 202, 202, 202, 202, 203, 203, 203, 203, 203, 203, 203, 204, 204, 204, 204, 204, 204, 204, 204, 204, 205, 205, 205, 205, 205, 205, 206, 206, 206, 206, 206, 206, 206, 206, 207, 207, 207, 207, 208, 208, 208, 208, 208, 208, 209, 209, 209, 209, 209, 209, 210, 210, 210, 210, 210, 210, 211, 211, 211, 211, 211, 212, 212, 212, 212, 212, 212, 212, 213, 213, 213, 213, 213, 214, 214, 214, 214, 214, 214, 214, 214, 215, 215, 215, 215, 215, 215, 215, 215, 216, 216, 216, 216, 216, 216, 216, 217, 217, 217, 217, 217, 218, 218, 218, 218, 218, 218, 219, 219, 219, 219, 219, 219, 219, 220, 220, 220, 220, 220, 221, 221, 221, 221, 221, 221, 222, 222, 222, 222, 222, 222, 222, 222, 222, 222, 222, 223, 223, 223, 223, 223, 223, 223, 223, 223, 223, 224, 224, 224, 224, 224, 224, 224, 224, 224, 224, 224, 224, 225, 225, 225, 225, 225, 225, 225, 225, 225, 225, 225, 225, 226, 226, 226, 226, 226, 226, 226, 226, 226, 226, 226, 226, 227, 227, 227, 227, 227, 228, 228, 228, 228, 229, 229, 229, 229, 229, 229, 229, 230, 230, 230, 230, 230, 230, 231, 231, 231, 231, 231, 231, 231, 232, 232, 232, 232, 232, 232, 232, 233, 233, 233, 233, 233, 234, 234, 234, 234, 234, 234, 235, 235, 235, 235, 235, 235, 235, 236, 236, 236, 236, 236, 236, 236, 237, 237, 237, 237, 237, 237, 237, 237, 238, 238, 238, 238, 238, 238, 238, 239, 239, 239, 239, 239, 239, 239, 239, 239, 239, 239, 239, 240, 240, 240, 240, 240, 240, 240, 240, 240, 240, 240, 241, 241, 241, 241, 241, 241, 241, 241, 241, 241, 241, 242, 242, 242, 242, 242, 242, 242, 242, 242, 243, 243, 243, 243, 244, 244, 244, 244, 244, 244, 244, 244, 244, 244, 244, 244, 244, 244, 245, 245, 245, 245, 245, 245, 245, 245, 245, 245, 245, 246, 246, 246, 246, 246, 246, 247, 247, 247, 247, 247, 247, 247, 248, 248, 248, 248, 248, 248, 248, 248, 249, 249, 249, 249, 249, 249, 249, 249, 249, 249, 249, 250, 250, 250, 250, 250, 250, 250, 250, 251, 251, 251, 251, 251, 251, 251, 251, 251, 251, 251, 252, 252, 252, 252, 252, 252, 253, 253, 253, 253, 253, 254, 254, 254, 254, 254, 254, 254, 254, 255, 255, 255, 255, 255, 255, 255, 255, 256, 256, 256, 256, 256, 256, 256, 256, 257, 257, 257, 257, 257, 257, 258, 258, 258, 258, 258, 259, 259, 259, 259, 259, 259, 259, 259, 259, 260, 260, 260, 260, 260, 260, 261, 261, 261, 261, 261, 261, 262, 262, 262, 262, 262, 262, 262, 262, 263, 263, 263, 263, 263, 263, 264, 264, 264, 264, 264, 264, 264, 264, 264, 265, 265, 265, 265, 266, 266, 266, 266, 266, 266, 266, 266, 266, 266, 266, 267, 267, 267, 267, 267, 267, 267, 268, 268, 268, 268, 268, 268, 268, 268, 269, 269, 269, 269, 269, 269, 269, 269, 269, 269, 270, 270, 270, 270, 270, 270, 270, 270, 271, 271, 271, 271, 272, 272, 272, 272, 272, 272, 272, 272, 272, 273, 273, 273, 273, 273, 273, 274, 274, 274, 274, 274, 274, 274, 274, 275, 275, 275, 275, 275, 275, 275, 275, 275, 276, 276, 276, 276, 276, 276, 276, 276, 276, 277, 277, 277, 277, 277, 277, 278, 278, 278, 278, 278, 278, 278, 279, 279, 279, 279, 279, 279, 280, 280, 280, 280, 281, 281, 281, 281, 281, 281, 281, 281, 281, 281, 281, 282, 282, 282, 282, 282, 282, 282, 282, 283, 283, 283, 283, 283, 283, 283, 283, 283, 283, 283, 284, 284, 284, 284, 284, 284, 284, 284, 285, 285, 285, 285, 286, 286, 286, 286, 286, 286, 287, 287, 287, 287, 287, 287, 287, 287, 287, 288, 288, 288, 288, 288, 288, 289, 289, 289, 289, 289, 289, 289, 289, 290, 290, 290, 290, 290, 290, 290, 290, 290, 290, 290, 290, 291, 291, 291, 291, 291, 291, 292, 292, 292, 292, 292, 292, 292, 292, 293, 293, 293, 293, 293, 293, 293, 294, 294, 294, 294, 294, 294, 295, 295, 295, 295, 295, 296, 296, 296, 296, 297, 297, 297, 297, 297, 297, 297, 298, 298, 298, 298, 298, 298, 299, 299, 299, 299, 299, 299, 299, 300, 300, 300, 300, 300, 300, 300, 300, 300, 301, 301, 301, 301, 301, 301, 301, 302, 302, 302, 302, 302, 302, 303, 303, 303, 303, 303, 303, 303, 303, 303, 304, 304, 304, 304, 304, 304, 304, 304, 304, 305, 305, 305, 305, 305, 305, 305, 305, 305, 306, 306, 306, 306, 306, 306, 306, 306, 306, 307, 307, 307, 307, 307, 307, 307, 307, 307, 308, 308, 308, 308, 308, 308, 308, 309, 309, 309, 309, 309, 309, 309, 309, 309, 310, 310, 310, 310, 310, 310, 310, 311, 311, 311, 311, 311, 311, 311, 311, 312, 312, 312, 312, 312, 312, 312, 312, 313, 313, 313, 313, 313, 313, 314, 314, 314, 314, 314, 314, 314, 315, 315, 315, 315, 315, 315, 315, 316, 316, 316, 316, 316, 316, 317, 317, 317, 317, 317, 318, 318, 318, 318, 318, 318, 318, 318, 318, 319, 319, 319, 319, 319, 319, 319, 319, 320, 320, 320, 320, 320, 320, 320, 320, 321, 321, 321, 321, 321, 321, 321, 321, 321, 322, 322, 322, 322, 323, 323, 323, 323, 323, 323, 324, 324, 324, 324, 324, 324, 324, 325, 325, 325, 325, 325, 325, 325, 325, 326, 326, 326, 326, 326, 326, 326, 326, 326, 326, 326, 327, 327, 327, 327, 327, 327, 327, 327, 327, 328, 328, 328, 328, 329, 329, 329, 329, 329, 329, 329, 329, 330, 330, 330, 330, 330, 330, 330, 330, 331, 331, 331, 331, 331, 331, 331, 331, 332, 332, 332, 332, 332, 332, 332, 332, 333, 333, 333, 333, 333, 333, 333, 333, 334, 334, 334, 334, 334, 334, 334, 334, 335, 335, 335, 335, 335, 335, 335, 335, 335, 335, 335, 336, 336, 336, 336, 336, 337, 337, 337, 337, 338, 338, 338, 338, 338, 338, 338, 338, 339, 339, 339, 339, 339, 339, 339, 339, 340, 340, 340, 340, 340, 340, 340, 340, 341, 341, 341, 341, 341, 342, 342, 342, 342, 342, 342, 343, 343, 343, 343, 343, 343, 343, 343, 343, 344, 344, 344, 344, 344, 344, 344, 344, 345, 345, 345, 345, 345, 345, 345, 345, 345, 346, 346, 346, 346, 346, 346, 346, 346, 347, 347, 347, 347, 347, 347, 347, 347, 347, 347, 347, 348, 348, 348, 348, 348, 348, 348, 348, 349, 349, 349, 349, 350, 350, 350, 350, 350, 350, 350, 350, 351, 351, 351, 351, 351, 351, 351, 351, 352, 352, 352, 352, 352, 352, 352, 352, 352, 353, 353, 353, 353, 353, 353, 353, 354, 354, 354, 354, 354, 354, 354, 355, 355, 355, 355, 355, 355, 355, 356, 356, 356, 356, 357, 357, 357, 357, 357, 357, 357, 357, 357, 357, 357, 357, 358, 358, 358, 358, 358, 358, 358, 359, 359, 359, 359, 359, 359, 359, 359, 359, 360, 360, 360, 360, 360, 360, 360, 360, 361, 361, 361, 361, 361, 361, 361, 361, 361, 361, 361, 362, 362, 362, 362, 362, 362, 362, 362, 362, 362, 363, 363, 363, 363, 363, 363, 364, 364, 364, 364, 364, 364, 364, 364, 364, 364, 365, 365, 365, 365, 365, 366, 366, 366, 366, 366, 366, 366, 366, 367, 367, 367, 367, 367, 367, 367, 368, 368, 368, 368, 368, 368, 369, 369, 369, 369, 369, 369, 369, 369, 370, 370, 370, 370, 370, 370, 371, 371, 371, 371, 371, 371, 371, 371, 371, 371, 371, 372, 372, 372, 372, 372, 372, 372, 372, 373, 373, 373, 373, 373, 373, 373, 373, 373, 374, 374, 374, 374, 374, 374, 374, 374, 375, 375, 375, 375, 375, 375, 375, 375, 376, 376, 376, 376, 376, 376, 376, 376, 376, 376, 376, 377, 377, 377, 377, 377, 377, 377, 377, 378, 378, 378, 378, 378, 378, 378, 378, 379, 379, 379, 379, 379, 379, 379, 379, 380, 380, 380, 380, 381, 381, 381, 381, 381, 381, 381, 381, 381, 382, 382, 382, 382, 382, 382, 382, 382, 382, 383, 383, 383, 383, 383, 383, 383, 383, 383, 384, 384, 384, 384, 384, 384, 384, 384, 385, 385, 385, 385, 385, 385, 385, 385, 385, 386, 386, 386, 386, 387, 387, 387, 387, 387, 387, 387, 387, 388, 388, 388, 388, 388, 388, 388, 388, 388, 388, 388, 388, 389, 389, 389, 389, 389, 389, 390, 390, 390, 390, 390, 390, 390, 390, 390, 390, 390, 391, 391, 391, 391, 391, 391, 391, 391, 391, 391, 391, 391, 392, 392, 392, 392, 392, 392, 392, 393, 393, 393, 393, 393, 393, 393, 393, 394, 394, 394, 394, 394, 394, 394, 394, 395, 395, 395, 395, 395, 395, 395, 395, 396, 396, 396, 396, 396, 396, 396, 396, 396, 397, 397, 397, 397, 397, 397, 397, 397, 398, 398, 398, 398, 398, 398, 398, 398, 399, 399, 399, 399, 399, 399, 399, 399, 399, 400, 400, 400, 400, 400, 400, 400, 400, 400, 401, 401, 401, 401, 401, 401, 401, 401, 402, 402, 402, 402, 402, 402, 402, 402, 402, 402, 402, 402, 402, 402, 403, 403, 403, 403, 403, 403, 403, 403, 404, 404, 404, 404, 404, 404, 404, 404, 404, 404, 404, 404, 404, 404, 405, 405, 405, 405, 405, 405, 405, 405, 406, 406, 406, 406, 406, 407, 407, 407, 407, 407, 407, 407, 407, 407, 407, 407, 408, 408, 408, 408, 408, 408, 408, 408, 409, 409, 409, 409, 409, 409, 409, 409, 410, 410, 410, 410, 410, 410, 410, 411, 411, 411, 411, 411, 411, 411, 411, 412, 412, 412, 412, 412, 412, 413, 413, 413, 413, 413, 414, 414, 414, 414, 415, 415, 415, 415, 415, 415, 415, 415, 415, 416, 416, 416, 416, 416, 416, 416, 416, 417, 417, 417, 417, 417, 417, 417, 417, 417, 417, 417, 417, 418, 418, 418, 418, 418, 418, 418, 418, 418, 418, 418, 419, 419, 419, 419, 419, 420, 420, 420, 420, 420, 420, 420, 420, 420, 420, 420, 421, 421, 421, 421, 421, 421, 421, 421, 422, 422, 422, 422, 422, 422, 422, 423, 423, 423, 423, 423, 423, 423, 423, 423, 424, 424, 424, 424, 424, 424, 424, 424, 425, 425, 425, 425, 425, 425, 426, 426, 426, 426, 426, 426, 426, 427, 427, 427, 427, 427, 427, 428, 428, 428, 428, 428, 428, 428, 428, 428, 429, 429, 429, 429, 429, 429, 429, 429, 430, 430, 430, 430, 430, 430, 430, 430, 430, 430, 430, 430, 431, 431, 431, 431, 431, 431, 431, 431, 431, 431, 431, 432, 432, 432, 432, 432, 432, 432, 432, 433, 433, 433, 433, 433, 433, 433, 433, 433, 434, 434, 434, 434, 434, 434, 434, 434, 434, 435, 435, 435, 435, 435, 435, 435, 436, 436, 436, 436, 436, 436, 436, 437, 437, 437, 437, 438, 438, 438, 438, 438, 438, 438, 439, 439, 439, 439, 439, 439, 439, 439, 439, 440, 440, 440, 440, 441, 441, 441, 441, 441, 441, 441, 441, 441, 441, 441, 442, 442, 442, 442, 442, 442, 442, 442, 442, 443, 443, 443, 443, 443, 444, 444, 444, 444, 444, 444, 444, 444, 444, 445, 445, 445, 445, 446, 446, 446, 446, 446, 446, 446, 446, 447, 447, 447, 447, 447, 447, 447, 447, 448, 448, 448, 448, 448, 448, 448, 448, 449, 449, 449, 449, 449, 449, 449, 450, 450, 450, 450, 450, 450, 450, 450, 450, 450, 450, 451, 451, 451, 451, 451, 451, 451, 451, 452, 452, 452, 452, 452, 452, 452, 452, 453, 453, 453, 453, 454, 454, 454, 454, 454, 454, 454, 454, 454, 455, 455, 455, 455, 455, 455, 455, 455, 455, 455, 455, 456, 456, 456, 456, 456, 457, 457, 457, 457, 457, 457, 458, 458, 458, 458, 458, 458, 459, 459, 459, 459, 459, 467, 467, 467, 467, 467, 468, 468, 468, 468, 468, 469, 469, 469, 469, 469, 469, 469, 469, 469, 470, 470, 470, 470, 470, 470, 470, 470, 470, 471, 471, 471, 471, 471, 471, 471, 471, 472, 472, 472, 472, 472, 472, 472, 472, 473, 473, 473, 473, 473, 473, 474, 474, 474, 474, 474, 474, 474, 474, 474, 475, 475, 475, 475, 475, 475, 475, 475, 475, 476, 476, 476, 476, 476, 476, 476, 476, 477, 477, 477, 477, 477, 477, 477, 477, 478, 478, 478, 478, 478, 478, 478, 478, 478, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1 }, atom-ids { 9, 2, 1, 10, 3, 5, 4, 11, 12, 10, 2, 1, 11, 3, 5, 6, 4, 7, 2, 1, 8, 3, 9, 4, 2, 1, 5, 7, 2, 1, 8, 3, 5, 4, 4, 2, 1, 5, 10, 2, 1, 11, 3, 5, 6, 4, 9, 2, 1, 10, 3, 4, 11, 12, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 7, 2, 1, 9, 3, 4, 10, 8, 9, 2, 1, 10, 3, 4, 11, 12, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 8, 2, 1, 10, 3, 5, 4, 11, 9, 8, 2, 1, 10, 3, 5, 4, 11, 9, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 11, 3, 6, 4, 5, 10, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 9, 3, 4, 10, 8, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 11, 4, 9, 2, 1, 10, 3, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 11, 3, 5, 4, 12, 13, 4, 2, 1, 5, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 11, 3, 6, 4, 5, 13, 2, 1, 16, 3, 6, 14, 4, 5, 15, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 7, 2, 1, 8, 3, 9, 9, 2, 1, 11, 3, 6, 4, 5, 10, 6, 2, 1, 7, 3, 10, 2, 1, 11, 3, 5, 9, 2, 1, 10, 3, 4, 11, 12, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 14, 3, 5, 4, 7, 2, 1, 8, 3, 9, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 7, 2, 1, 8, 3, 5, 4, 9, 2, 1, 11, 3, 6, 4, 5, 10, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 10, 3, 11, 4, 9, 2, 1, 10, 3, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 9, 2, 1, 10, 3, 11, 4, 10, 2, 1, 11, 3, 5, 4, 12, 13, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 6, 4, 5, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 9, 2, 1, 10, 3, 4, 5, 6, 2, 1, 7, 3, 4, 2, 1, 5, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 6, 4, 5, 4, 2, 1, 5, 9, 2, 1, 10, 3, 4, 11, 12, 10, 2, 1, 11, 3, 6, 4, 5, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 7, 2, 1, 8, 3, 5, 4, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 10, 3, 11, 4, 9, 2, 1, 10, 3, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 4, 2, 1, 5, 20, 2, 1, 22, 3, 8, 4, 5, 21, 6, 7, 10, 11, 9, 9, 2, 1, 11, 3, 6, 4, 5, 10, 10, 2, 1, 11, 3, 6, 4, 5, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 17, 2, 1, 18, 3, 7, 2, 1, 9, 3, 4, 10, 8, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 6, 2, 1, 7, 3, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 10, 3, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 8, 2, 1, 9, 3, 5, 10, 4, 9, 2, 1, 10, 3, 11, 4, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 11, 3, 6, 4, 5, 10, 9, 2, 1, 10, 3, 4, 11, 12, 10, 2, 1, 11, 3, 5, 6, 4, 4, 2, 1, 5, 10, 2, 1, 11, 3, 6, 4, 5, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 5, 6, 4, 9, 2, 1, 10, 3, 11, 4, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 4, 2, 1, 5, 6, 2, 1, 7, 3, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 11, 3, 5, 4, 12, 13, 9, 2, 1, 11, 3, 6, 4, 5, 10, 7, 2, 1, 9, 3, 4, 10, 8, 6, 2, 1, 7, 3, 9, 2, 1, 10, 3, 4, 11, 12, 10, 2, 1, 11, 3, 6, 4, 5, 7, 2, 1, 8, 3, 9, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 11, 3, 6, 4, 5, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 11, 4, 9, 2, 1, 10, 3, 4, 5, 9, 2, 1, 10, 3, 4, 11, 12, 20, 2, 1, 22, 3, 8, 4, 5, 21, 6, 7, 10, 11, 9, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 10, 3, 4, 11, 12, 6, 2, 1, 7, 3, 9, 2, 1, 10, 3, 4, 5, 7, 2, 1, 8, 3, 9, 7, 2, 1, 9, 3, 4, 10, 8, 7, 2, 1, 9, 3, 4, 10, 8, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 11, 3, 5, 6, 4, 9, 2, 1, 10, 3, 4, 5, 4, 2, 1, 5, 7, 2, 1, 9, 3, 4, 10, 8, 9, 2, 1, 11, 3, 6, 4, 5, 10, 7, 2, 1, 8, 3, 5, 4, 7, 2, 1, 8, 3, 5, 4, 9, 2, 1, 11, 3, 6, 4, 5, 10, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 8, 3, 9, 4, 2, 1, 5, 9, 2, 1, 10, 3, 4, 11, 12, 10, 2, 1, 11, 3, 6, 4, 5, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 5, 4, 4, 2, 1, 5, 9, 2, 1, 10, 3, 11, 4, 8, 2, 1, 9, 3, 5, 10, 4, 10, 2, 1, 11, 3, 10, 2, 1, 11, 3, 5, 4, 12, 13, 9, 2, 1, 11, 3, 6, 7, 2, 1, 8, 3, 5, 4, 8, 2, 1, 9, 3, 5, 10, 4, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 9, 2, 1, 11, 3, 6, 4, 5, 10, 9, 2, 1, 10, 3, 11, 4, 9, 2, 1, 10, 3, 11, 4, 10, 2, 1, 11, 3, 5, 6, 4, 7, 2, 1, 9, 3, 4, 10, 8, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 5, 4, 12, 13, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 7, 2, 1, 9, 3, 4, 10, 8, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 7, 2, 1, 8, 3, 9, 20, 2, 1, 22, 3, 8, 4, 5, 21, 6, 7, 10, 11, 9, 9, 2, 1, 10, 3, 11, 4, 9, 2, 1, 10, 3, 11, 4, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 7, 2, 1, 8, 3, 9, 8, 2, 1, 10, 3, 5, 4, 11, 9, 9, 2, 1, 11, 3, 6, 4, 5, 10, 8, 2, 1, 9, 3, 5, 10, 4, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 5, 4, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 11, 4, 7, 2, 1, 8, 3, 9, 4, 2, 1, 5, 9, 2, 1, 11, 3, 6, 4, 5, 10, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 6, 2, 1, 7, 3, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 11, 4, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 9, 3, 4, 10, 8, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 9, 13, 2, 1, 16, 3, 6, 14, 4, 5, 15, 7, 2, 1, 8, 3, 5, 4, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 6, 4, 5, 4, 2, 1, 5, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 9, 6, 2, 1, 7, 3, 7, 2, 1, 8, 3, 5, 4, 9, 2, 1, 10, 3, 7, 2, 1, 9, 3, 4, 10, 8, 9, 2, 1, 10, 3, 4, 11, 12, 9, 2, 1, 10, 3, 11, 4, 6, 2, 1, 7, 3, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 4, 5, 6, 2, 1, 7, 3, 7, 2, 1, 8, 3, 9, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 13, 2, 1, 16, 3, 6, 14, 4, 5, 15, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 6, 2, 1, 7, 3, 4, 2, 1, 5, 9, 2, 1, 10, 3, 4, 5, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 4, 5, 7, 2, 1, 8, 3, 5, 4, 6, 2, 1, 7, 3, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 5, 4, 7, 2, 1, 8, 3, 5, 4, 7, 2, 1, 9, 3, 4, 10, 8, 9, 2, 1, 10, 3, 11, 4, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 4, 2, 1, 5, 20, 2, 1, 22, 3, 8, 4, 5, 21, 6, 7, 10, 11, 9, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 4, 5, 9, 2, 1, 10, 3, 4, 11, 12, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 9, 2, 1, 10, 3, 4, 11, 12, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 7, 2, 1, 8, 3, 9, 6, 2, 1, 7, 3, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 11, 3, 6, 4, 5, 7, 2, 1, 8, 3, 9, 6, 2, 1, 7, 3, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 4, 11, 12, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 4, 2, 1, 5, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 9, 2, 1, 10, 3, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 13, 2, 1, 16, 3, 6, 14, 4, 5, 15, 9, 2, 1, 10, 3, 4, 11, 12, 4, 2, 1, 5, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 8, 3, 9, 8, 2, 1, 9, 3, 5, 10, 4, 8, 2, 1, 10, 3, 5, 4, 11, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 5, 4, 7, 2, 1, 8, 3, 9, 4, 2, 1, 5, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 7, 2, 1, 9, 3, 4, 10, 8, 4, 2, 1, 5, 7, 2, 1, 8, 3, 9, 8, 2, 1, 10, 3, 5, 4, 11, 9, 7, 2, 1, 8, 3, 9, 8, 2, 1, 9, 3, 5, 10, 4, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 5, 6, 4, 7, 2, 1, 8, 3, 5, 4, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 4, 2, 1, 5, 7, 2, 1, 8, 3, 5, 4, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 5, 4, 9, 2, 1, 11, 3, 6, 4, 5, 10, 9, 2, 1, 10, 3, 4, 5, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 10, 2, 1, 11, 3, 5, 4, 12, 13, 10, 2, 1, 11, 3, 5, 4, 12, 13, 9, 2, 1, 11, 3, 6, 4, 5, 10, 9, 2, 1, 11, 3, 6, 4, 5, 10, 9, 2, 1, 10, 3, 11, 4, 9, 2, 1, 11, 3, 6, 4, 5, 10, 9, 2, 1, 10, 3, 11, 4, 10, 2, 1, 11, 3, 5, 6, 4, 9, 2, 1, 10, 3, 4, 11, 12, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 4, 5, 9, 2, 1, 10, 3, 11, 4, 7, 2, 1, 8, 3, 9, 6, 2, 1, 7, 3, 8, 2, 1, 10, 3, 5, 4, 11, 9, 8, 2, 1, 9, 3, 5, 10, 4, 10, 2, 1, 11, 3, 6, 4, 5, 8, 2, 1, 10, 3, 5, 4, 11, 9, 4, 2, 1, 5, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 11, 4, 10, 2, 1, 11, 3, 5, 6, 4, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 9, 2, 1, 11, 3, 6, 4, 5, 10, 4, 2, 1, 5, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 10, 2, 1, 14, 3, 4, 2, 1, 5, 7, 2, 1, 9, 3, 4, 10, 8, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 5, 6, 4, 6, 2, 1, 7, 3, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 4, 12, 13, 7, 2, 1, 9, 3, 4, 10, 8, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 8, 2, 1, 9, 3, 5, 10, 4, 4, 2, 1, 5, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 11, 3, 5, 4, 12, 13, 9, 2, 1, 10, 3, 4, 5, 9, 2, 1, 10, 3, 4, 5, 9, 2, 1, 10, 3, 11, 4, 4, 2, 1, 5, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 9, 2, 1, 10, 3, 4, 5, 9, 2, 1, 11, 3, 6, 4, 5, 10, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 13, 2, 1, 16, 3, 6, 14, 4, 5, 15, 7, 2, 1, 8, 3, 9, 13, 2, 1, 16, 3, 6, 14, 4, 5, 15, 6, 2, 1, 7, 3, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 10, 3, 4, 5, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 6, 4, 5, 7, 2, 1, 8, 3, 9, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 11, 3, 6, 4, 5, 10, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 10, 2, 1, 11, 3, 6, 4, 5, 4, 2, 1, 5, 10, 2, 1, 11, 3, 5, 4, 12, 13, 10, 2, 1, 11, 3, 5, 4, 12, 13, 8, 2, 1, 10, 3, 5, 4, 11, 9, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 4, 12, 13, 4, 2, 1, 5, 7, 2, 1, 9, 3, 4, 10, 8, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 7, 2, 1, 8, 3, 9, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 9, 2, 1, 10, 3, 4, 5, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 10, 3, 4, 11, 12, 7, 2, 1, 9, 3, 4, 10, 8, 8, 2, 1, 10, 3, 5, 4, 11, 9, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 6, 4, 5, 8, 2, 1, 10, 3, 5, 4, 11, 9, 8, 2, 1, 10, 3, 5, 4, 11, 9, 10, 2, 1, 11, 3, 6, 4, 5, 20, 2, 1, 22, 3, 8, 4, 5, 21, 6, 7, 10, 11, 9, 9, 2, 1, 10, 3, 4, 11, 12, 20, 2, 1, 22, 3, 8, 4, 5, 21, 6, 7, 10, 11, 9, 9, 2, 1, 10, 3, 4, 11, 12, 13, 2, 1, 16, 3, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 7, 2, 1, 9, 3, 4, 10, 8, 10, 2, 1, 11, 3, 6, 4, 5, 9, 2, 1, 10, 3, 11, 4, 10, 2, 1, 11, 3, 5, 6, 4, 9, 2, 1, 11, 3, 6, 6, 2, 1, 7, 3, 4, 2, 1, 5, 9, 2, 1, 11, 3, 6, 4, 5, 10, 8, 2, 1, 9, 3, 5, 10, 4, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 6, 2, 1, 7, 3, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 7, 2, 1, 9, 3, 4, 10, 8, 7, 2, 1, 8, 3, 5, 4, 9, 2, 1, 11, 3, 6, 4, 5, 10, 10, 2, 1, 11, 3, 6, 4, 5, 7, 2, 1, 8, 3, 9, 9, 2, 1, 10, 3, 4, 5, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 10, 2, 1, 11, 3, 5, 6, 4, 17, 2, 1, 18, 3, 8, 4, 5, 6, 7, 9, 19, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 8, 2, 1, 9, 3, 5, 10, 4, 10, 2, 1, 11, 3, 5, 4, 12, 13, 10, 2, 1, 11, 3, 5, 4, 12, 13, 9, 2, 1, 10, 3, 4, 5, 9, 2, 1, 10, 3, 11, 4, 4, 2, 1, 5, 9, 2, 1, 10, 3, 11, 4, 9, 2, 1, 11, 3, 6, 4, 5, 10, 4, 2, 1, 5, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 8, 2, 1, 10, 3, 5, 4, 11, 9, 7, 2, 1, 8, 3, 9, 2, 1, 11, 3, 6, 4, 5, 10, 4, 2, 1, 5, 9, 2, 1, 10, 3, 4, 11, 12, 10, 2, 1, 11, 3, 5, 6, 4, 7, 2, 1, 9, 3, 4, 10, 8, 9, 2, 1, 10, 3, 11, 4, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 7, 2, 1, 9, 3, 4, 10, 8, 7, 2, 1, 9, 3, 4, 10, 8, 4, 2, 1, 5, 10, 2, 1, 11, 3, 5, 4, 12, 13, 10, 2, 1, 14, 3, 5, 4, 11, 6, 12, 13, 6, 2, 1, 7, 3, 7, 2, 1, 8, 3, 9, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 9, 2, 1, 11, 3, 10, 2, 1, 11, 3, 8, 2, 1, 10, 3, 5, 4, 11, 9, 9, 2, 1, 11, 3, 6, 4, 5, 10, 10, 2, 1, 11, 3, 6, 4, 5, 10, 2, 1, 11, 3, 5, 6, 4, 7, 2, 1, 8, 3, 9, 10, 2, 1, 11, 3, 5, 4, 12, 13, 10, 2, 1, 11, 3, 5, 4, 12, 13, 9, 2, 1, 10, 3, 4, 11, 12, 10, 2, 1, 11, 3, 6, 4, 5, 7, 2, 1, 9, 3, 4, 10, 8, 11, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1 } }, sites { scale-factor 1000, x { 54256, 54602, 53508, 52685, 55907, 56138, 57382, 58404, 57424, 53608, 52768, 53122, 54258, 52925, 52560, 52036, 53150, 52235, 52435, 51429, 50290, 52159, 53019, 51851, 50973, 51703, 52916, 51056, 49605, 48932, 49403, 49397, 50632, 51637, 47787, 46896, 47710, 48510, 47586, 48307, 47338, 46150, 48556, 49561, 49043, 49678, 47767, 46938, 47428, 48423, 47003, 45909, 45660, 45253, 47096, 47441, 46530, 45338, 47212, 47888, 47669, 49376, 47004, 46283, 47019, 48240, 45703, 46361, 46002, 45082, 44269, 44153, 43455, 46248, 46800, 47635, 47303, 47704, 46878, 45749, 47499, 48566, 49204, 49061, 49687, 50668, 50879, 50441, 51391, 48411, 48328, 49622, 49621, 47968, 47467, 46216, 48233, 45746, 47788, 46542, 46144, 50786, 52078, 52434, 53266, 53174, 52863, 53990, 53945, 54920, 51628, 51724, 51219, 51576, 50861, 51566, 51554, 51168, 52016, 50440, 49913, 51042, 50913, 48950, 47502, 46837, 46687, 52252, 53422, 53944, 54492, 54609, 54539, 54768, 55316, 56537, 53524, 53827, 53268, 53402, 53250, 53888, 52964, 52528, 51628, 51068, 51377, 52445, 51653, 52210, 51870, 50186, 49202, 47846, 49018, 53270, 53819, 54310, 54301, 54876, 55893, 57095, 58123, 56993, 54633, 55054, 54066, 54228, 56379, 57413, 57499, 58348, 53129, 52107, 51215, 50750, 51182, 52076, 51287, 50339, 49250, 48085, 50944, 51410, 52110, 49646, 48732, 48895, 49987, 48925, 48056, 48656, 47855, 47908, 47397, 46223, 47113, 47677, 47027, 47169, 48264, 47832, 47413, 48161, 48875, 48490, 49561, 50654, 49571, 46117, 45498, 44531, 43988, 44304, 43318, 43953, 45119, 42403, 43058, 43704, 43130, 44361, 43769, 44367, 44971, 43250, 43764, 42897, 41689, 43830, 44212, 45538, 44551, 43389, 42681, 43173, 44357, 42893, 42372, 42717, 41519, 42080, 41329, 42308, 42750, 41884, 40753, 42668, 43481, 43161, 43170, 42314, 41484, 42136, 43338, 41127, 42091, 41517, 42371, 41270, 41602, 42618, 43580, 42091, 41233, 41892, 39823, 42543, 43523, 42829, 41726, 44101, 45267, 44538, 45561, 43622, 43048, 43928, 44885, 42767, 41731, 43687, 44465, 44252, 43145, 44046, 45147, 44693, 44890, 44371, 45371, 45361, 45011, 45668, 46700, 44031, 43528, 44702, 44761, 42405, 42061, 45584, 46821, 47660, 47692, 47579, 47696, 46644, 48833, 48354, 49120, 48343, 47168, 49511, 50159, 50931, 50044, 51540, 50618, 51372, 51999, 49041, 48443, 48035, 47615, 49385, 49218, 47776, 48198, 47825, 48628, 49326, 46385, 46547, 48495, 49069, 48248, 47088, 49086, 49953, 50931, 49770, 51698, 50536, 51508, 52262, 48782, 48019, 48811, 49916, 47842, 47815, 46885, 47090, 46464, 45644, 46674, 48276, 48865, 48181, 47708, 48774, 49106, 50373, 48127, 50653, 48358, 49612, 48494, 48032, 48558, 48329, 48514, 49404, 49300, 49450, 49991, 49014, 49189, 51378, 52032, 53563, 54115, 54024, 48300, 47370, 46186, 45271, 46823, 45947, 46637, 45591, 46138, 45045, 44230, 43111, 45548, 46396, 46230, 44735, 43995, 44271, 45195, 44293, 43630, 43884, 43319, 43301, 42659, 41546, 42346, 43026, 41995, 42358, 43342, 42806, 41741, 41202, 43961, 44726, 44775, 41524, 40434, 39506, 38922, 41064, 42061, 42517, 42638, 42799, 39639, 38666, 39405, 40513, 37654, 38247, 38487, 38577, 38980, 39049, 39263, 39763, 38683, 39111, 38201, 36995, 39011, 39349, 40668, 39496, 38700, 37955, 38595, 39714, 37998, 37984, 37076, 37286, 37846, 38133, 37203, 35985, 37944, 39064, 38513, 39630, 37792, 36895, 37351, 38487, 36704, 36447, 37413, 35200, 37124, 34885, 35877, 36471, 36753, 38037, 38981, 36911, 35869, 35921, 35822, 34950, 33702, 35237, 38001, 39101, 38539, 37535, 39624, 40407, 40425, 39094, 38617, 39613, 40757, 38302, 39200, 40136, 40262, 40587, 39985, 40003, 38643, 37587, 40274, 40265, 41172, 40637, 38658, 37462, 37096, 35986, 37689, 37832, 37404, 37424, 37036, 37766, 37539, 38516, 39716, 37743, 37501, 38054, 38956, 39646, 40762, 38247, 37283, 36974, 37767, 39000, 39773, 40998, 41855, 41013, 42194, 43363, 44436, 42012, 41205, 40912, 40819, 43145, 44175, 44347, 45470, 43920, 43902, 43541, 45211, 43296, 43423, 42655, 41874, 42987, 43465, 42532, 44815, 42945, 45229, 44293, 43053, 42444, 42453, 42005, 43308, 44669, 44269, 43058, 43204, 42875, 43099, 44637, 44735, 44644, 44880, 42309, 41940, 40929, 40073, 41476, 40819, 41918, 40202, 41081, 40150, 39424, 38270, 41028, 41729, 40262, 40047, 39351, 39613, 40724, 39856, 39173, 39675, 38600, 38696, 38157, 36987, 37831, 38222, 37856, 37149, 38906, 38605, 37643, 36944, 39961, 39993, 41290, 41411, 40977, 40440, 41061, 37688, 36982, 37199, 36363, 38439, 38757, 38606, 38585, 40177, 40626, 40199, 41691, 40917, 41826, 42473, 42770, 43389, 43525, 38659, 38305, 37585, 37950, 39453, 39838, 41025, 41276, 42530, 36477, 35742, 35733, 36082, 34290, 34115, 32832, 34089, 35430, 35176, 33670, 32830, 35513, 35348, 36378, 34142, 36217, 33963, 35005, 33293, 31919, 31043, 30075, 31223, 31043, 30250, 30686, 30137, 28763, 28274, 28319, 27839, 31455, 31617, 32977, 33943, 31473, 30078, 29868, 28954, 28611, 27661, 27497, 26258, 33027, 34257, 34729, 35795, 33999, 33832, 34188, 33530, 32320, 33798, 33801, 35140, 33637, 34174, 33438, 33898, 35069, 33666, 32974, 33165, 33078, 33361, 32508, 31330, 32941, 33893, 32898, 33424, 33082, 32346, 32856, 34027, 32347, 31581, 30387, 32051, 29611, 31290, 30083, 32023, 32248, 33422, 34298, 32479, 31136, 30855, 31473, 30058, 33352, 34409, 34012, 33335, 34299, 35412, 36802, 36340, 34449, 34175, 34885, 36115, 34666, 34013, 34332, 34237, 34747, 34522, 34752, 36241, 36494, 36847, 36308, 34308, 34324, 33163, 32048, 34185, 34323, 35785, 33847, 33451, 32363, 31970, 30978, 32801, 32759, 32984, 33772, 34098, 32685, 32299, 33209, 34160, 32293, 33662, 34579, 33931, 32822, 33675, 34854, 35970, 32983, 31835, 34007, 31629, 34618, 35477, 36279, 37023, 36190, 36763, 36312, 35950, 36496, 36943, 36710, 38412, 36704, 36329, 36989, 36630, 36491, 37919, 38571, 38615, 39901, 39927, 40548, 41834, 37752, 38093, 37673, 38047, 39603, 40112, 39738, 40864, 36845, 36473, 35484, 34449, 35948, 35525, 36606, 35198, 35810, 34920, 34466, 33553, 35568, 36356, 35425, 34582, 34900, 36047, 33990, 34992, 34549, 34907, 36086, 35186, 34687, 35191, 33665, 33969, 34129, 33803, 32627, 33239, 33928, 33132, 33055, 34719, 34532, 33728, 33392, 35902, 36819, 35954, 33669, 33046, 32701, 33379, 33965, 33105, 33917, 33511, 34045, 35162, 33454, 31567, 31082, 30470, 30471, 29920, 29086, 29745, 30921, 27708, 29030, 29569, 28738, 27533, 29669, 28345, 30091, 28437, 29432, 28773, 29200, 30343, 29186, 28548, 28659, 27950, 27778, 28334, 27012, 28326, 28612, 27729, 26637, 28457, 29374, 28850, 29324, 28175, 27491, 28039, 29120, 27471, 26567, 26349, 26763, 25787, 27191, 27219, 28287, 29102, 27275, 27019, 26537, 26751, 27165, 28137, 29022, 28275, 28067, 29534, 30372, 31337, 29927, 27989, 27195, 27294, 26211, 27494, 28484, 28559, 28818, 29127, 29659, 29684, 28870, 30448, 28670, 28986, 27937, 26748, 29159, 29640, 30950, 29791, 28361, 27378, 27881, 28660, 27285, 26568, 27328, 27795, 27674, 28445, 29189, 28950, 29087, 28560, 28852, 28287, 28432, 28161, 26587, 26361, 25212, 25269, 25990, 26497, 25778, 26136, 24104, 22949, 23165, 22326, 21754, 21964, 24242, 24554, 25522, 25948, 25368, 26502, 24677, 25737, 26594, 25759, 24941, 27683, 28570, 28693, 26072, 25310, 26146, 26740, 24862, 23879, 23699, 23220, 26029, 26777, 26558, 27382, 26568, 27195, 26465, 28587, 27311, 28631, 29778, 29792, 30972, 30937, 25493, 25201, 26133, 26212, 23757, 23433, 26662, 27701, 29054, 29645, 27920, 26795, 27292, 26237, 29316, 30480, 30305, 31224, 30793, 30969, 31992, 31053, 29089, 28895, 27661, 26599, 28499, 28823, 29128, 27625, 27742, 26610, 25520, 24481, 27017, 27349, 27536, 27413, 25754, 24947, 24694, 24777, 25628, 24115, 23813, 22735, 22616, 23202, 24265, 22095, 21920, 20886, 21396, 20615, 20093, 20882, 22615, 23298, 24031, 24535, 24324, 23724, 22695, 24379, 24057, 24721, 23950, 22716, 24737, 25631, 26070, 25830, 24592, 24093, 24373, 25505, 24682, 24018, 23083, 24357, 22510, 23801, 22868, 22296, 23461, 23637, 22729, 21538, 23234, 23711, 23640, 24455, 23286, 22533, 23422, 24537, 21967, 22800, 20807, 22899, 23381, 24265, 25132, 23985, 24858, 24153, 23113, 25257, 26131, 26984, 25945, 24674, 24073, 22902, 22960, 25166, 24750, 25512, 25043, 26080, 21806, 20559, 20621, 20904, 19549, 20134, 21617, 20318, 20448, 19993, 20556, 19704, 20040, 20123, 18879, 18268, 19138, 19237, 16894, 16219, 14797, 14194, 12720, 19779, 20827, 22136, 22883, 21101, 19867, 20164, 21339, 19201, 22506, 23693, 23598, 24473, 23952, 24565, 22514, 22387, 23443, 23925, 23717, 24794, 24519, 23392, 25041, 25320, 25726, 25102, 25532, 25314, 26409, 27598, 25208, 24063, 24515, 22837, 26024, 26992, 27650, 27074, 26358, 25985, 28826, 29497, 28543, 27859, 30601, 30861, 29618, 28444, 27610, 26245, 25786, 25649, 24314, 24060, 23005, 24016, 24063, 22686, 25003, 24884, 25027, 24353, 25907, 25456, 23687, 23664, 25974, 26022, 24856, 23893, 27317, 24984, 23935, 24434, 23988, 23128, 21687, 21347, 21284, 21199, 25276, 25810, 26228, 27368, 26989, 26972, 25196, 25463, 26503, 26319, 24125, 23370, 23789, 27563, 28530, 28358, 28788, 29924, 30118, 30716, 29841, 27681, 27493, 26306, 25224, 27422, 28533, 26409, 25355, 24299, 24488, 26051, 26476, 25817, 26470, 24646, 23142, 22011, 21615, 21466, 20714, 20560, 19480, 18409, 17951, 21333, 20775, 19532, 19346, 21831, 22053, 23119, 18781, 17689, 17983, 18219, 16297, 15662, 16157, 17912, 18182, 16937, 16655, 19437, 20722, 19589, 21899, 16318, 15112, 13954, 13544, 15526, 14497, 14344, 13749, 13644, 12717, 13003, 12100, 11315, 10943, 10917, 10658, 14226, 14655, 15647, 16582, 15283, 15028, 14517, 13869, 14763, 15344, 16231, 17058, 16519, 15434, 16174, 16980, 16065, 17634, 16734, 17516, 18174, 18331, 19203, 20665, 21163, 19085, 18939, 19233, 18449, 21373, 22794, 23673, 23389, 23223, 22759, 21931, 23081, 21438, 22583, 21757, 21171, 24579, 25517, 26921, 27548, 25537, 24210, 23372, 21974, 21144, 21477, 19909, 27493, 28787, 29407, 28755, 28576, 27812, 30764, 31430, 31631, 31703, 32769, 32689, 32730, 32588, 32636, 32557, 32535, 32441, 32446, 32405, 31682, 31964, 31290, 30982, 33480, 34309, 33676, 31269, 30924, 31714, 31204, 31253, 31505, 30104, 32977, 33793, 34096, 34556, 35130, 34897, 34412, 35229, 33626, 33808, 32529, 31862, 34925, 36324, 37288, 38569, 39298, 38877, 40474, 32230, 31199, 31646, 32835, 30940, 30363, 30659, 30948, 31218, 30458, 29749, 29809, 28757, 27898, 28857, 32213, 32479, 31659, 31679, 33966, 34865, 36337, 37178, 38499, 31165, 30388, 31051, 31770, 28927, 27855, 26911, 26738, 30796, 31342, 30297, 29133, 31965, 33623, 30688, 29717, 29120, 29820, 30523, 31910, 32066, 27801, 27050, 27630, 27606, 25594, 25474, 28108, 28870, 29802, 29843, 29805, 28943, 30605, 30643, 31583, 30951, 31648, 32416, 33347, 29689, 29038, 29444, 29609, 29842, 30359, 31868, 32486, 30058, 28568, 28207, 26713, 26368, 32487, 33885, 34221, 33336, 34505, 34670, 34386, 35622, 35968, 35026, 37162, 35521, 35962, 36221, 36220, 37167, 36544, 36836, 37834, 37952, 35510, 34785, 38422, 39462, 38857, 37633, 40237, 40288, 41684, 39610, 39139, 38382, 37690, 40395, 40479, 39235, 38356, 39060, 38666, 38025, 37033, 36845, 39021, 39722, 40364, 39622, 36384, 35356, 35784, 34992, 34120, 33806, 33475, 33980, 36955, 37342, 37314, 37922, 38702, 38846, 39579, 39385, 40282, 36605, 36600, 37978, 38884, 35824, 34196, 38124, 39338, 39236, 38165, 39590, 39644, 40254, 40290, 39284, 39176, 41712, 41996, 41501, 42665, 41887, 42563, 38738, 37780, 38440, 37698, 37248, 38131, 38758, 39792, 40439, 40718, 41238, 41727, 41397, 40778, 40766, 40226, 40612, 40997, 39892, 38746, 41288, 42923, 40232, 39169, 39310, 40400, 39266, 38274, 36879, 38331, 38264, 38403, 38466, 37668, 39622, 39832, 41144, 41781, 39909, 40600, 41599, 42824, 43453, 42862, 42629, 41380, 44734, 45506, 45331, 45529, 47022, 47546, 45105, 44980, 43962, 43957, 46333, 43117, 41951, 42409, 43611, 41104, 42021, 43042, 41537, 41912, 43289, 43728, 41783, 44068, 45366, 45300, 45198, 46336, 47697, 48254, 48513, 45666, 45618, 46818, 46998, 45430, 46671, 46590, 47766, 47719, 48883, 48681, 49596, 50201, 50403, 50436, 47559, 47259, 46207, 45775, 46908, 45744, 44802, 45166, 46300, 44536, 44256, 44226, 44575, 44453, 45303, 43693, 43952, 43811, 43728, 43630, 43292, 42846, 42536, 43285, 42753, 41460, 41265, 43804, 45494, 40503, 39281, 39562, 38737, 38647, 37314, 36538, 36272, 35534, 34925, 35342, 40556, 40988, 42363, 42506, 41057, 39710, 39082, 38820, 37881, 37681, 43359, 44712, 45725, 45776, 45144, 44318, 43193, 44623, 42401, 43847, 42739, 41915, 46584, 47655, 48872, 49080, 48020, 49286, 49299, 50487, 50450, 51656, 51639, 52886, 49634, 50814, 51784, 51492, 50455, 51741, 52121, 52580, 53289, 53758, 54099, 55267, 52978, 54061, 53600, 53663, 54528, 53076, 52585, 51312, 51028, 50643, 49489, 48255, 48344, 49908, 48627, 51002, 47100, 45881, 45456, 44964, 44746, 45149, 45637, 45445, 44111, 43599, 46618, 46798, 47838, 43482, 42153, 42361, 41498, 41537, 42683, 43830, 43615, 43998, 45502, 46195, 43440, 45984, 47430, 48001, 47650, 47816, 47608, 49127, 49911, 50487, 50848, 50984, 50912, 49692, 50676, 51323, 52545, 53218, 51695, 50652, 50405, 52837, 53895, 53897, 54962, 55258, 55357, 56044, 54631, 52817, 52617, 51279, 50669, 52461, 51227, 53552, 51051, 49949, 49232, 49922, 50457, 51099, 52467, 50376, 53092, 50972, 52339, 53013, 47895, 47177, 47627, 47937, 45675, 45116, 43573, 43114, 43123, 43513, 42788, 47779, 48182, 47382, 47543, 49678, 50235, 50165, 50785, 50676, 51294, 51281, 46738, 45964, 44752, 44390, 46953, 47867, 47207, 46380, 47354, 44135, 43048, 43428, 42474, 44637, 44797, 45998, 46253, 44774, 46012, 46424, 47019, 47595, 47998, 47186, 49150, 48336, 49322, 46888, 48168, 48771, 48394, 49203, 49885, 51129, 51586, 52629, 53344, 53072, 49625, 50246, 51695, 52476, 50102, 48386, 52121, 53417, 53969, 53230, 53568, 53089, 53129, 55291, 55895, 56315, 56292, 57091, 58126, 59067, 58167, 56545, 56950, 58134, 58086, 57223, 57594, 57814, 56658, 55632, 55642, 54641, 59149, 60287, 59881, 60291, 61740, 62421, 63124, 62272, 59116, 58457, 57624, 57811, 57468, 56701, 57101, 55559, 56414, 54847, 55294, 56734, 55895, 56827, 56552, 54903, 53562, 57872, 58687, 59551, 60147, 59529, 59657, 60546, 59907, 60552, 61667, 62696, 63468, 62607, 58612, 57828, 58127, 58196, 56329, 55778, 55477, 54479, 58290, 58680, 60193, 60691, 58175, 56671, 56310, 55965, 60942, 62352, 62973, 64127, 62924, 63381, 62322, 62933, 62663, 62880, 62570, 62069, 61742, 62117, 62059, 60226, 59687, 58364, 58080, 57598, 62298, 62725, 61558, 61496, 63753, 63306, 60617, 59423, 59683, 60048, 58179, 57436, 59364, 59358, 58121, 57851, 59268, 59389, 59473, 59404, 57259, 56047, 56310, 57396, 55020, 55149, 55320, 55362, 55098, 54368, 54359, 54575, 55374, 55493, 55832, 55801, 55671, 54622, 53951, 54537, 53637, 53571, 54446, 53924, 53356, 53760, 52383, 53225, 51879, 52260, 52360, 52118, 51506, 51202, 51315, 51626, 49890, 51539, 50867, 49806, 50116, 51791, 52403, 50922, 53421, 48528, 47491, 46423, 46076, 46885, 45915, 46356, 44551, 45282, 44175, 45952, 44948, 45226, 44357, 43573, 42919, 41737, 43407, 46477, 46839, 46818, 46775, 47015, 47108, 48211, 48445, 45752, 45778, 44413, 43545, 44223, 48942, 50046, 49321, 48713, 51098, 52337, 49373, 48586, 49426, 50167, 47136, 46923, 45477, 45659, 49378, 50041, 49721, 50526, 49618, 49329, 49275, 49941, 48451, 48566, 48222, 47444, 46760, 47387, 47154, 48359, 49356, 48242, 47495, 46718, 45205, 44760, 47039, 48629, 44380, 42946, 42487, 43083, 42445, 43605, 44824, 41370, 40815, 41003, 41225, 39280, 39320, 40775, 40968, 42248, 42249, 43213, 44506, 45630, 45738, 44938, 43958, 44142, 42839, 43272, 41931, 42141, 46670, 47907, 49081, 49078, 47945, 49092, 48041, 49194, 50126, 51396, 51945, 51931, 52300, 52295, 53078, 52823, 51862, 51065, 51651, 52362, 52733, 54078, 54431, 52838, 54053, 54628, 54400, 54931, 55971, 56091, 55584, 56915, 57109, 57750, 58700, 57944, 58283, 57227, 57738, 57773, 58163, 59139, 59037, 58539, 58192, 58492, 57021, 56696, 55665, 54993, 56024, 55639, 55774, 54875, 53557, 52630, 55507, 56571, 56977, 55745, 53380, 52363, 51361, 51733, 52947, 53570, 54932, 52887, 55548, 53501, 54822, 55581, 50071, 49017, 48295, 47892, 47973, 48766, 48136, 47399, 46240, 46165, 48267, 48920, 49291, 49234, 45150, 43958, 44253, 45053, 43170, 43533, 45009, 43607, 43811, 43219, 43744, 43229, 44408, 42009, 41391, 40971, 41421, 42311, 40153, 39640, 39895, 40408, 39561, 39958, 41480, 42147, 39488, 38470, 38928, 42039, 43464, 44109, 43621, 43665, 43501, 45310, 46055, 46341, 46372, 47267, 47454, 46087, 46310, 46484, 46964, 46413, 45176, 45346, 44013, 44388, 43662, 48150, 48802, 48526, 48913, 50292, 51008, 50495, 47910, 47645, 48594, 48852, 46186, 45070, 49183, 50174, 50096, 50162, 51603, 51760, 51989, 53011, 51147, 49867, 49672, 50866, 51911, 48285, 47339, 45930, 45438, 45249, 50899, 51932, 52276, 53381, 51467, 52307, 51758, 50762, 52310, 51291, 51479, 51381, 50703, 50467, 51208, 50313, 50740, 50938, 52000, 51934, 50562, 50010, 53022, 54419, 55257, 55708, 54649, 49979, 48709, 47514, 47412, 48714, 49834, 47392, 46675, 45456, 44391, 44074, 45043, 43601, 43390, 42703, 42758, 43895, 42862, 41468, 41162, 43161, 41909, 44032, 40684, 39363, 38334, 38132, 39120, 39896, 37655, 39847, 37871, 36991, 35589, 34729, 37546, 37761, 38525, 37154, 35278, 34053, 33998, 34802, 34121, 34373, 33001, 32849, 33492, 34029, 31360, 31024, 30927, 33468, 34029, 35541, 36217, 33618, 32403, 33339, 36071, 37500, 38077, 39293, 37785, 37298, 37310, 37750, 37689, 37702, 36833, 37361, 37185, 38380, 38294, 36857, 36624, 35265, 34256, 35356, 39562, 40846, 41118, 41597, 41950, 41740, 43123, 42486, 40740, 40907, 40209, 40344, 40440, 41091, 41005, 42557, 39267, 38482, 39367, 40262, 37373, 36611, 35337, 35362, 34218, 39092, 39855, 41126, 41584, 41719, 42938, 42924, 42105, 43458, 43325, 43994, 44164, 45154, 45277, 44623, 45245, 43432, 46021, 47114, 47265, 47406, 48473, 48394, 49586, 49595, 47170, 47312, 48682, 49024, 46166, 46403, 46186, 46917, 46447, 47136, 46924, 49623, 50964, 50895, 50901, 52050, 53254, 54528, 55400, 56260, 50760, 50647, 49845, 49858, 49286, 48467, 47038, 46736, 49185, 50624, 50954, 51425, 46090, 44691, 44352, 44509, 43751, 43768, 42864, 43283, 43933, 43367, 41872, 41562, 43958, 43301, 43501, 43844, 41029, 39606, 38959, 38867, 38885, 39550, 37413, 39479, 38569, 38014, 36666, 36462, 38960, 38668, 37845, 39290, 35644, 34332, 33271, 32726, 33788, 34737, 32362, 34346, 32919, 31910, 30492, 29664, 32262, 33729, 34102, 34361, 34011, 33409, 34256, 30208, 28878, 28479, 29316, 28835, 27298, 26986, 25568, 24801, 25243, 23886, 23790, 23544, 23714, 24403, 25598, 23604, 24290, 24529, 25697, 25520, 23252, 22777, 22715, 22441, 26897, 28136, 28783, 29472, 29040, 29726, 28194, 28897, 28409, 28892, 28786, 28910, 28068, 28204, 27910, 28487, 29119, 26426, 26145, 28373, 29001, 30525, 31273, 28595, 27118, 26898, 27209, 26423, 31022, 32415, 32963, 34079, 32759, 32687, 33224, 33401, 32166, 32555, 32706, 33501, 31592, 32266, 31324, 30614, 31237, 32151, 32285, 33532, 33636, 31024, 31110, 31188, 31155, 34419, 35540, 36712, 37770, 35123, 34457, 33090, 35148, 32425, 34512, 33152, 36482, 37500, 37368, 38210, 37402, 37426, 37566, 38408, 36296, 35998, 36980, 37033, 37791, 38735, 40144, 40931, 38873, 37871, 37705, 38247, 40446, 41729, 42031, 41367, 41814, 41535, 43121, 41172, 43002, 43381, 44502, 44798, 43907, 42912, 43034, 43881, 42330, 45342, 46512, 46828, 46843, 47759, 47766, 48988, 47074, 47586, 49043, 49366, 46725, 47347, 45293, 49972, 51392, 51746, 52463, 52374, 52273, 52210, 51127, 51358, 50505, 50364, 49910, 48982, 47582, 47458, 49557, 49473, 48333, 50639, 48352, 50706, 49552, 49726, 46593, 45197, 44760, 44792, 44211, 42815, 44748, 44387, 43898, 42423, 42056, 44845, 44340, 45040, 45958, 45416, 41602, 40164, 39888, 40014, 39297, 39769, 37887, 39423, 39567, 39472, 38382, 38336, 40783, 40805, 41943, 41473, 42297, 43612, 41834, 37514, 36372, 35295, 34686, 37000, 37849, 38628, 38049, 39256, 38923, 35222, 34402, 33005, 32653, 35231, 35713, 32243, 30954, 29879, 29297, 30485, 31493, 31870, 32194, 32798, 32992, 29949, 29211, 29318, 28576, 29678, 30158, 30415, 29974, 30305, 31885, 32740, 34192, 32118, 29521, 29072, 29923, 29965, 27557, 26923, 26697, 30591, 31487, 32590, 32352, 30658, 31300, 33631, 34716, 34645, 35569, 36073, 36325, 37669, 36207, 33437, 33089, 33060, 33228, 31673, 30771, 32967, 33223, 34654, 35005, 32952, 33724, 34805, 33371, 35498, 34048, 35119, 35633, 36928, 36715, 37224, 38171, 38411, 38853, 39260, 35970, 35527, 36646, 36636, 34546, 33645, 32529, 31674, 31083, 37657, 38765, 40043, 41031, 39080, 38009, 37892, 37160, 40091, 41305, 41712, 41151, 41099, 42396, 43135, 42030, 42801, 43320, 44556, 44746, 43706, 44288, 44286, 45377, 46618, 46966, 47571, 45375, 46526, 47043, 46868, 47596, 48806, 50031, 49010, 47448, 48042, 49524, 49801, 47342, 45871, 48115, 44999, 50454, 51866, 52609, 53576, 52575, 52234, 52926, 52616, 52175, 52831, 54249, 55026, 54549, 55849, 56078, 57216, 56055, 55402, 56050, 56160, 56379, 54980, 55091, 54006, 53097, 55051, 54739, 54676, 55062, 54264, 54347, 53498, 53426, 54131, 53914, 54489, 54950, 55186, 55043, 52375, 52257, 53204, 53582, 50814, 49818, 48611, 49405, 53659, 54410, 53828, 52635, 54424, 55045, 54195, 53150, 54565, 54614, 54181, 54286, 53930, 54441, 54479, 53095, 52836, 55500, 56925, 57199, 58063, 52214, 50846, 50563, 50727, 49823, 49925, 50343, 49625, 50401, 49699, 50087, 50151, 50020, 49591, 48097, 47686, 49798, 51185, 47321, 45867, 45372, 45542, 45241, 43764, 43406, 42768, 42050, 41454, 41063, 44819, 44596, 43194, 42841, 45579, 45760, 46822, 44927, 47057, 45157, 46207, 46374, 42417, 40958, 40531, 40508, 40075, 38612, 40666, 40299, 39948, 38821, 38760, 41200, 41023, 41128, 42078, 38015, 36888, 35936, 35831, 37445, 36466, 36750, 35311, 35299, 34305, 32932, 32749, 34804, 35992, 36013, 37075, 32073, 30771, 29874, 29407, 29848, 30173, 29817, 28835, 30628, 29717, 28783, 29367, 28586, 27969, 27231, 26591, 27258, 30682, 31312, 30923, 31422, 32827, 33606, 33417, 35070, 30241, 29688, 30490, 30528, 28236, 27235, 25944, 25097, 25856, 31058, 31938, 33113, 33107, 31215, 30717, 30678, 30906, 30341, 34073, 35175, 34866, 34258, 36378, 36638, 37658, 36919, 35297, 34975, 34223, 34408, 36279, 36971, 36719, 37981, 37488, 38286, 38643, 39212, 39546, 39820, 33503, 32947, 34005, 34245, 31918, 30853, 31177, 29693, 34449, 35412, 35034, 35387, 35859, 36504, 36460, 37294, 37165, 37686, 37703, 38477, 38471, 38860, 34281, 33771, 33730, 34245, 32352, 32273, 33306, 31130, 33239, 33176, 34445, 34470, 31943, 35433, 36541, 37880, 37989, 36165, 35457, 35362, 36281, 37564, 38169, 38309, 38958, 40311, 41257, 41251, 40938, 41986, 41813, 43028, 42041, 42896, 44151, 44141, 42153, 42992, 43488, 42094, 45281, 46588, 47426, 47382, 47454, 46870, 48909, 48077, 48897, 50319, 50656, 48409, 46911, 49216, 46322, 51073, 52434, 53326, 54081, 53071, 53756, 53254, 54064, 53301, 52495, 55334, 53675, 53057, 52017, 51684, 51385, 50289, 49110, 49077, 50884, 51198, 52288, 52785, 52426, 48091, 46890, 46623, 46963, 45629, 45836, 44511, 44002, 45893, 45355, 43853, 43376, 46156, 45583, 45730, 44884, 45196, 44379, 44535, 44053, 43068, 41644, 41251, 41375, 40772, 40675, 41552, 39638, 41402, 39486, 40358, 40554, 40015, 38837, 38871, 41090, 37829, 36742, 35762, 35352, 37157, 37832, 39221, 37006, 39783, 37572, 38964, 35459, 34477, 33432, 33617, 35183, 36407, 36426, 37541, 32453, 31463, 30577, 30223, 30731, 30947, 32213, 30320, 29431, 30158, 29582, 28556, 28209, 26743, 26030, 25949, 31425, 32261, 32709, 33696, 33463, 34390, 33821, 35825, 31995, 32342, 33771, 34288, 31249, 29916, 34529, 35943, 36105, 37180, 36644, 36715, 35962, 35090, 35091, 35515, 36332, 33685, 34088, 34965, 35384, 36870, 37671, 34594, 33115, 32785, 32729, 32581, 37265, 38631, 39498, 40592, 38759, 37968, 40257, 38038, 38987, 39729, 39779, 40654, 39180, 39538, 38653, 40810, 38953, 41155, 40221, 40564, 38819, 38747, 39718, 40637, 37348, 37345, 37270, 37698, 36835, 35610, 37021, 39541, 40437, 41891, 42530, 40237, 41254, 40829, 41582, 42331, 43622, 44016, 45133, 43704, 44121, 44623, 44718, 44905, 43178, 43505, 43675, 44728, 42458, 41191, 40181, 39521, 40080, 42670, 42711, 43939, 44607, 41451, 41547, 40203, 44282, 45335, 46701, 47714, 45199, 44913, 44108, 46836, 48102, 48800, 49983, 48112, 48731, 48590, 49003, 47967, 46600, 48208, 48089, 47927, 49249, 49996, 47114, 46677, 45832, 44385, 43667, 49517, 50733, 51716, 52684, 51445, 52343, 51760, 52195, 52617, 51847, 52060, 52244, 52326, 52258, 52468, 50732, 49959, 50326, 50227, 48457, 47669, 47623, 47714, 47477, 50474, 50643, 49259, 48398, 51104, 48914, 47559, 46659, 45428, 47426, 46673, 45883, 46390, 45368, 47214, 46368, 45803, 44963, 46300, 45914, 44438, 43610, 46754, 48213, 48693, 49091, 44043, 42652, 42027, 41718, 42505, 43211, 41030, 43468, 41625, 41013, 39518, 38816, 41283, 40415, 39287, 40990, 39071, 37682, 36920, 35750, 37497, 37913, 38354, 37539, 36887, 36267, 35186, 37845, 38385, 39487, 40706, 41544, 41176, 42601, 36800, 36107, 35849, 35330, 36725, 38243, 38779, 38707, 36126, 35769, 34603, 34785, 36947, 37936, 37646, 39153, 33444, 32313, 31500, 30302, 31910, 31266, 29762, 29022, 31739, 32348, 32368, 31368, 33417, 29288, 27843, 27213, 26423, 27448, 28467, 27775, 27301, 27802, 28890, 27225, 27499, 26947, 26802, 27706, 27832, 25653, 25431, 26418, 26458, 23991, 23422, 27197, 28287, 27949, 27065, 29527, 30844, 28607, 28445, 28826, 29080, 27046, 40696, 41033, 40017, 40393, 42462, 38749, 37684, 36306, 35413, 37925, 36135, 34832, 34755, 33736, 34471, 34277, 34067, 35011, 32792, 35849, 35982, 35779, 35879, 37377, 38287, 39413, 39985, 41252, 35530, 35193, 36421, 36465, 34256, 32779, 32404, 32432, 37345, 38597, 39623, 39158, 38480, 39870, 37769, 39888, 40911, 41898, 43294, 43510, 41969, 43190, 44246, 45624, 46272, 46768, 46547, 46221, 47370, 48315, 47480, 45955, 46129, 45735, 46421, 45303, 45645, 46397, 45768, 47637, 44748, 44446, 45206, 44967, 42947, 42047, 42114, 41154, 45933, 46659, 48017, 48860, 46722, 45746, 44324, 46072, 48306, 49497, 49350, 49891, 49734, 51191, 52082, 51459, 48510, 59581, 59964, 60725, 61873, 61359, 62465, 58400, 57323, 58738, 61417, 62661, 60625, 62745, 58879, 33073, 31597, 31159, 32099, 33636, 34712, 29849, 28822, 30586, 29913, 31620, 34010, 34347, 29966, 35313, 35016, 34050, 33899, 34348, 34630, 34563, 34468, 34528, 35504, 31603, 31348, 31081, 30095, 30537, 29475, 32442, 33677, 32543, 30571, 30011, 30568, 28408, 31363, 49927, 50538, 51967, 52643, 52039, 52746, 49299, 48526, 49662, 52535, 54067, 50671, 52088, 49541, 55429, 56578, 57563, 56852, 55905, 55220, 57191, 57812, 57208, 58588, 57804, 54937, 54914, 56686, 53691, 53649, 53495, 52296, 52546, 51568, 54884, 53403, 51128, 52558, 57953, 58642, 58874, 59659, 59035, 59952, 58181, 58935, 58949, 59680, 59830, 58834, 60966, 57020, 61083, 60942, 62198, 62752, 62881, 63572, 59881, 61946, 64017, 61574, 62804, 62595, 62394, 60921, 60439, 60643, 60029, 63233, 60770, 59089, 62060, 60199, 37234, 38452, 37611, 36533, 36333, 56567, 56597, 57964, 55749, 55886, 34533, 35274, 35476, 33552, 33773, 35466, 35613, 36002, 35880, 33958, 47653, 47849, 48594, 46187, 47799, 56527, 55870, 57759, 56619, 55623, 40639, 40218, 42089, 39823, 40424, 44996, 45080, 46109, 45032, 43762, 29970, 42522, 37561, 50446, 56668, 50605, 55123, 17414, 44263, 45085, 33537, 19279, 11502, 24591, 56947, 58092, 48308, 25776, 30644, 38739, 22886, 30938, 32412, 41019, 54268, 37130, 42585, 43661, 27980, 59527, 61146, 30380, 46835, 39446, 46992, 44263, 33670, 52469, 49985, 24074, 35207, 31231, 41726, 48564, 49501, 54851, 30459, 57310 }, y { 10338, 11778, 12557, 11863, 11986, 11019, 11319, 10754, 12013, 13860, 14699, 14711, 15029, 16122, 16006, 17122, 17176, 14409, 14677, 15708, 15521, 13415, 12004, 16709, 17718, 18407, 18345, 19212, 19341, 18217, 17094, 20703, 21036, 19947, 18438, 17336, 16365, 16863, 15111, 14053, 13762, 13843, 12797, 12857, 11700, 14249, 13631, 13283, 12000, 12143, 14469, 14379, 13262, 15374, 10817, 9505, 9137, 9420, 8483, 8917, 7085, 8947, 8417, 8088, 7373, 7288, 9358, 10169, 11635, 12226, 13262, 13891, 13803, 6654, 5917, 4736, 3701, 6798, 7732, 7451, 8869, 4822, 3570, 3322, 3849, 3568, 4026, 3185, 5120, 2187, 1672, 1839, 2321, 196, -357, -24, -1247, -541, -1778, -1420, -1977, 1541, 1681, 3058, 3292, 1318, -78, -515, -161, -1254, 4038, 5399, 5530, 6500, 6220, 6605, 8104, 9005, 8378, 4535, 4449, 4280, 4601, 3295, 3425, 2063, 4424, 3936, 3914, 5270, 5262, 3252, 1733, 1278, -141, -225, 6344, 7673, 7924, 9010, 8702, 8764, 9362, 10703, 11444, 10941, 12656, 7069, 7282, 6428, 6810, 6924, 7371, 6743, 8866, 5708, 4833, 5417, 4652, 3960, 4840, 4077, 4795, 2885, 6659, 7204, 8141, 8456, 8003, 7051, 5855, 7469, 8711, 9614, 9089, 7923, 9921, 10328, 9801, 9482, 10599, 10414, 9481, 10843, 8571, 11797, 12855, 13447, 13963, 13979, 15157, 13566, 13450, 14094, 15490, 15776, 13299, 11896, 14039, 11155, 16472, 17847, 18376, 19069, 18703, 20144, 20762, 20937, 21175, 18104, 18503, 17400, 16715, 17209, 16188, 14946, 15147, 16794, 17256, 16355, 18572, 16706, 18972, 18021, 18425, 13900, 12730, 12342, 12165, 11611, 10258, 10396, 9203, 12285, 11891, 10538, 10388, 12801, 14155, 15120, 14753, 16281, 16093, 9542, 8271, 8043, 7589, 7204, 7555, 5830, 6575, 8489, 8235, 7296, 7370, 9515, 10688, 11812, 11229, 6722, 6175, 5073, 5077, 7262, 8537, 9587, 8313, 4212, 3184, 1844, 1531, 3346, 4371, 2043, 4704, 833, -510, -1564, -1954, -882, -1846, -2017, -3014, -4362, -4772, -3131, -3654, -4575, -6025, -6989, -5080, -6396, -7473, -7627, -6655, -8301, -9352, -10263, -10778, -10164, -11176, -10415, -11148, -10564, -11056, -11050, -12387, -12978, -12848, -9479, -8706, -8529, -8182, -7393, -6281, -5325, -6115, -4280, -5102, -4181, -3127, -8653, -8549, -7136, -6371, -9160, -10649, -11107, -6754, -5412, -4715, -5259, -5520, -6140, -3395, -2488, -2381, -2851, -1119, -1021, -1935, 50, -1781, 214, -712, -563, -1567, -1285, -285, -552, -2611, -2375, -3327, -2927, -3536, -4529, -3139, 866, 1944, 2123, 3223, 3249, 2937, 3051, 2428, 2715, 2096, 2244, 1338, 1530, 2768, 2830, 319, -464, 97, 3533, 4679, 5848, 6827, 4981, 3995, 3976, 4648, 6132, 5886, 7004, 7022, 6187, 6919, 7967, 9310, 7738, 8041, 8151, 9425, 9451, 8207, 9340, 6957, 10415, 11664, 12305, 11863, 12708, 14066, 12311, 12939, 13575, 14939, 14830, 12864, 11611, 13802, 10559, 16058, 17305, 17961, 19030, 18338, 18567, 17926, 17477, 17953, 16789, 16311, 18512, 19552, 20396, 19908, 21559, 16353, 15342, 14115, 14360, 15802, 16476, 15733, 17844, 16243, 18384, 17569, 18047, 13021, 11812, 11548, 11632, 10663, 9314, 9477, 8093, 11348, 11201, 10047, 10205, 12446, 12514, 11460, 13807, 9008, 7832, 7825, 7993, 6588, 6534, 6890, 5162, 7898, 8002, 7052, 7073, 9448, 9815, 9706, 10301, 10063, 10655, 10521, 6118, 5281, 4494, 4513, 5993, 7020, 7562, 6422, 5832, 6277, 4729, 3625, 2743, 1337, 1224, 3066, 1872, 4352, 371, -992, -1934, -1602, -1483, -3105, -4079, -3902, -4835, -2734, -2443, -2881, -2430, -953, -423, -1164, 1047, -3862, -4448, -4007, -4332, -5956, -6484, -7940, -8698, -8320, -3042, -2523, -1405, -1692, -3596, -2971, -289, 758, 462, 947, 2083, 2476, 3951, 2200, -346, -672, -1508, -1724, -2189, -2834, -1837, -2269, -3417, -4678, -5341, -5065, -609, 352, 1107, 1210, 1393, 882, 2037, 200, 1737, 2564, 1999, 2734, 3973, 4501, 4748, 4767, 5263, 5256, 5506, 852, 237, 1089, 630, -983, -564, 58, 2220, 3032, 4477, 5201, 2916, 1638, 1619, 475, 4809, 6207, 6569, 5737, 6373, 7713, 8721, 7518, 7585, 7826, 9155, 9322, 7744, 6485, 7831, 10198, 11474, 12045, 11808, 12445, 13801, 11910, 12555, 13340, 14718, 14777, 12769, 11314, 13630, 10556, 15733, 16901, 17733, 18637, 17475, 18836, 18957, 17817, 18016, 19104, 17012, 17661, 18409, 19880, 20775, 20321, 21740, 22418, 23624, 21943, 23343, 24235, 24001, 25413, 25288, 23625, 26213, 24548, 25794, 21684, 22153, 20960, 19843, 22498, 23911, 24350, 25811, 25752, 21267, 20157, 20023, 20947, 20315, 20319, 21080, 18955, 18813, 18653, 18911, 18045, 17226, 16901, 17130, 16361, 16769, 16061, 16238, 20155, 20590, 19985, 19210, 20231, 20461, 20057, 18679, 18206, 20046, 21164, 22343, 20876, 17900, 16504, 16367, 16977, 15579, 15733, 16291, 15371, 16445, 15533, 16072, 16315, 15691, 15325, 13962, 13481, 15370, 13173, 11805, 11429, 11421, 10860, 9363, 8915, 8432, 11300, 11032, 9684, 9407, 12085, 11675, 13402, 8728, 7433, 7206, 6881, 6384, 6420, 4954, 5613, 7464, 7371, 6384, 6296, 8776, 9081, 9772, 8721, 10111, 9086, 9764, 5519, 4601, 3734, 3411, 5231, 5865, 5776, 6651, 4813, 3209, 2401, 1005, 298, 2659, 2156, 3306, 4405, 518, -900, -1874, -1777, -1281, -488, -2715, -2983, -4068, -3838, -4814, -4315, -4849, -4080, -6153, -2609, -2277, -2986, -2936, -786, -296, -537, 1177, -3863, -4648, -4054, -4502, -6075, -6976, -8446, -9160, -10556, -3071, -2384, -1224, -1074, -3292, -3562, -2825, -4782, -366, 820, 322, 669, 2006, 2488, 3133, 3958, -393, -972, -84, -572, 1221, 2215, 1976, 2863, 3636, 3980, 5479, 3599, 851, 395, 1059, 813, -1104, -1559, -1380, -2112, -1743, -2505, -2321, -2662, 2091, 2979, 4385, 5364, 2911, 1804, 1864, 845, 4640, 6040, 6508, 5874, 6140, 7482, 8513, 7169, 7456, 7841, 9273, 9743, 7657, 6375, 5183, 5320, 4847, 4214, 5070, 10065, 11450, 12149, 12067, 12291, 13685, 14593, 13932, 12669, 13551, 14909, 15106, 13185, 12034, 14408, 11293, 15789, 16983, 17950, 19060, 17607, 16503, 18411, 17777, 18809, 18328, 17381, 20011, 21174, 22444, 23376, 23608, 22929, 24543, 18809, 18385, 17008, 16306, 16560, 15371, 14335, 14332, 15721, 13337, 12273, 11928, 12179, 10967, 10237, 11140, 8872, 11423, 11107, 9738, 9611, 12085, 11653, 12912, 12726, 13503, 14695, 12925, 8754, 7376, 6959, 6482, 6461, 7012, 5021, 6250, 7199, 7103, 6072, 5538, 8443, 8402, 9840, 10662, 10106, 5556, 4440, 3421, 3103, 4764, 6194, 6355, 7804, 8045, 2677, 1570, 277, -361, 1868, 3153, 3016, 4174, -188, -1376, -2504, -2998, -1884, -2823, -3980, -3586, -4536, -4945, -5119, -5976, -4447, -2327, -1885, -2376, -2248, -389, 331, -101, 1830, -2967, -3407, -2921, -1960, -4907, -5622, -3456, -3010, -1523, -778, -3572, -5032, -6045, -5337, -7350, -6630, -7641, -8924, -1045, 405, 910, 1759, 715, 2014, 2448, 3057, 137, 435, 60, 280, -330, -1762, -698, -1165, -206, -642, -2461, -2020, -3622, 1001, 1964, 3127, 3750, 2542, 3599, 1565, 3636, 4734, 5985, 6400, 4335, 5303, 6520, 4865, 6649, 7856, 9010, 9977, 8296, 7372, 6450, 7208, 5712, 6186, 7845, 5783, 7445, 6405, 8931, 10041, 9975, 10857, 10042, 8917, 8792, 8607, 9226, 10001, 7132, 6324, 5024, 7117, 9217, 9743, 11178, 11985, 8886, 7413, 9434, 6457, 11495, 12865, 13525, 12867, 12616, 12805, 11405, 13581, 14811, 15542, 15659, 15032, 16944, 17137, 16122, 18331, 16398, 16776, 15669, 15791, 17987, 14565, 13440, 13732, 13106, 12241, 11441, 12701, 14777, 15139, 15516, 15642, 16277, 17369, 15911, 16353, 15230, 15484, 17372, 18709, 19079, 19441, 14035, 12959, 12749, 12755, 11703, 11965, 13121, 10923, 12251, 11983, 10578, 10317, 12861, 12741, 13671, 11717, 13579, 11615, 12562, 12504, 9660, 8249, 7708, 7890, 7450, 8057, 5984, 7100, 6997, 6481, 5670, 6172, 7627, 8375, 7034, 4562, 3805, 2696, 2003, 2418, 1390, 66, -15, 1774, 3022, 3077, 4021, -990, -2299, -2431, -2099, -3328, -4686, -5743, -7131, -8093, -3047, -3118, -4050, -5236, -3602, -3299, -3469, -3533, -4233, -5655, -6592, -3288, -1910, -2054, -5924, -7229, -8137, -9346, -7050, -8232, -8422, -9717, -9610, -7649, -8446, -8470, -9437, -8069, -7579, -7413, -7636, -7053, -7484, -7588, -8702, -9524, -6301, -5091, -8743, -9744, -9627, -10603, -8426, -8198, -8854, -8820, -6703, -6034, -6796, -4819, -9369, -9908, -9454, -9734, -11409, -12101, -13421, -12372, -8773, -8189, -9325, -10405, -7144, -5635, -9072, -10094, -10734, -10075, -9323, -8159, -7838, -12049, -12804, -13230, -14318, -12468, -12683, -14094, -14664, -11661, -10417, -11995, -14655, -15973, -17106, -18122, -16190, -15675, -15857, -17214, -17057, -18102, -17890, -18654, -18158, -16906, -16629, -15915, -16117, -17865, -17546, -16080, -15733, -15317, -14942, -14119, -12793, -12592, -14805, -14427, -12007, -10701, -10025, -9934, -9978, -10671, -12122, -9522, -8735, -7234, -6443, -9178, -10630, -11621, -10905, -6819, -5384, -4777, -5324, -5099, -6064, -3522, -2675, -2340, -2423, -1412, -1364, -135, 473, 208, -1815, -1499, -40, 484, -2244, -3639, -4432, -5012, -6372, 570, 1943, 1881, 897, 2952, 2689, 2842, 2985, 2991, 4051, 5206, 3096, 4385, 2740, 3725, 4672, 4524, 3435, 4335, 4305, 5346, 3665, 5635, 5633, 4739, 3879, 5253, 5696, 5112, 6763, 4728, 3759, 2306, 1544, 4106, 5487, 5779, 6448, 1907, 513, 379, 1172, 278, -953, -605, 466, -1437, -462, -688, -1938, -3024, -861, -1168, -210, -2429, -469, -2675, -1718, -2017, -1752, -2898, -2712, -1760, -3278, -4766, -5646, -5048, -3796, -3929, -3099, -2983, -5374, -6274, -7316, -6132, -8181, -7016, -8038, -9006, -2318, -1496, -2094, -2557, -132, 623, 344, 760, 570, 22, 1021, -2183, -2758, -2395, -2017, -4253, -5181, -2517, -2091, -3268, -3121, -1409, -69, 257, 1186, 1636, 2217, 1520, 3565, 2822, 3817, -4460, -5644, -6814, -6539, -6062, -5025, -7271, -8000, -9236, -9539, -10202, -10500, -10066, -11489, -9130, -9392, -8189, -8377, -10024, -11218, -12294, -11063, -7022, -5820, -4977, -4476, -4962, -5501, -4948, -5605, -5895, -5608, -6478, -4728, -3924, -2463, -2227, -4282, -5944, -1600, -177, 89, -327, 619, 2085, 2867, 2304, 4164, 866, 1064, 2205, 3305, 1275, 267, 734, -208, -654, 2014, 3041, 3200, 2292, 2613, 2955, 1601, 1855, 4195, 4365, 4320, 4649, 5772, 5771, 3978, 3933, 5320, 6345, 3487, 3920, 3777, 5367, 6592, 7476, 8708, 6287, 4935, 6853, 7507, 8583, 9739, 6459, 5365, 7048, 8247, 9116, 10331, 11327, 8372, 7001, 10322, 11521, 11834, 10932, 13052, 13520, 13299, 13935, 15035, 15288, 16733, 16806, 16181, 12441, 12171, 10851, 10007, 12070, 13400, 13330, 13280, 12407, 11486, 12463, 10795, 9557, 8525, 8908, 9921, 7304, 6302, 5304, 5291, 5741, 4524, 4499, 3584, 2404, 2315, 3142, 4248, 2864, 1408, 145, -579, -1537, -612, -1146, -983, -1884, 41, -312, -947, 43, 281, -1394, -2692, -3273, -3183, 795, 1734, 2563, 2827, 880, 95, 654, -1206, 3164, 4054, 5463, 5676, 3624, 3717, 2532, 2406, 1821, 6393, 7721, 8315, 8057, 8664, 8100, 9192, 9889, 11287, 11704, 10070, 8597, 12075, 13461, 14184, 13851, 13952, 15330, 16404, 15813, 17528, 17207, 15293, 15987, 16519, 17045, 17107, 17210, 15840, 16535, 17139, 16084, 16405, 17891, 19251, 20282, 20344, 21198, 14830, 13764, 13628, 13920, 12491, 12246, 13579, 13446, 12109, 11568, 14505, 14365, 14243, 15599, 11359, 10098, 9061, 8102, 9079, 7898, 8068, 9084, 6631, 5597, 7123, 7307, 6035, 4963, 8258, 7602, 6145, 4950, 4713, 3614, 5083, 6204, 5806, 5684, 6747, 7792, 5926, 6416, 7257, 8535, 8725, 6470, 5483, 5166, 9492, 10710, 11300, 12202, 10255, 10999, 11551, 12284, 11794, 10379, 10896, 11105, 11170, 13565, 14432, 14315, 15148, 15926, 16543, 17699, 15926, 13425, 13114, 11712, 11282, 13176, 11977, 14314, 11057, 9760, 9747, 8632, 8775, 10905, 11030, 10331, 9967, 12501, 13494, 10085, 9547, 10750, 10897, 8427, 7873, 7144, 11759, 12985, 14071, 13604, 12919, 15334, 16382, 17055, 17598, 17478, 16935, 17133, 17906, 19286, 19845, 18074, 18687, 18338, 16947, 16080, 16599, 14780, 19981, 21291, 21260, 20753, 22251, 22344, 21388, 23360, 21815, 23010, 21847, 21992, 21095, 20913, 23430, 24234, 24869, 24358, 25633, 25131, 25745, 26522, 20514, 19653, 20507, 21514, 18639, 17926, 16858, 18407, 16221, 17791, 16707, 16186, 20253, 21001, 20356, 20133, 22343, 23126, 23557, 23409, 24275, 24118, 24549, 25254, 20080, 19557, 18309, 18218, 20620, 17360, 16135, 16330, 15538, 17495, 17671, 18173, 19279, 18610, 18896, 18035, 17518, 18117, 19350, 19248, 17132, 15753, 20534, 21769, 22321, 22183, 22736, 23878, 21913, 23105, 23625, 24913, 25482, 23877, 24287, 23385, 25400, 26569, 26662, 25879, 27807, 27508, 27518, 28340, 29513, 28034, 26789, 27853, 28569, 29852, 29957, 27581, 26417, 26557, 30875, 32143, 31886, 30892, 32814, 32277, 30822, 32757, 32623, 31425, 30935, 32653, 33855, 33783, 34910, 30657, 29567, 29875, 30864, 28248, 28343, 27886, 29488, 29959, 28813, 27810, 30907, 32125, 32085, 33230, 33152, 34310, 34243, 35289, 28990, 27892, 27737, 28730, 28127, 28944, 28957, 29683, 31015, 31562, 31778, 26542, 26269, 25089, 24013, 25940, 25653, 26567, 24417, 26232, 24101, 25010, 25301, 24269, 23771, 22611, 23144, 23415, 23965, 23205, 25109, 24589, 24154, 23107, 22473, 22636, 21536, 21517, 20501, 20271, 19885, 20308, 18983, 19727, 18906, 18254, 18128, 17478, 17425, 22485, 22472, 23863, 24793, 21602, 22309, 21552, 21665, 21044, 20236, 21126, 23881, 25199, 25217, 24239, 25392, 25049, 26288, 26468, 27812, 28770, 26357, 24988, 27602, 27820, 29115, 29883, 29288, 28946, 27997, 27795, 27395, 31163, 32057, 31685, 31923, 33485, 34424, 35811, 36150, 36823, 37118, 37118, 30974, 30739, 29536, 29443, 30726, 32122, 32682, 32928, 28609, 27601, 28290, 28010, 26746, 25801, 24479, 26213, 23597, 25372, 24070, 29225, 29870, 30598, 30534, 30778, 31544, 31256, 32071, 31167, 31735, 33088, 29859, 29073, 27959, 26965, 28497, 29635, 29840, 30321, 28136, 27107, 26886, 25709, 27322, 26675, 26595, 27317, 27960, 27764, 27622, 27511, 29012, 29196, 30654, 28222, 27559, 27529, 26497, 26731, 27318, 25980, 25389, 24488, 24964, 24139, 23039, 26109, 26621, 28078, 29009, 26457, 25049, 25032, 24088, 26002, 28338, 29625, 30466, 30889, 29269, 29419, 30785, 31540, 33032, 33588, 31297, 30334, 33659, 35071, 35706, 36918, 35285, 36713, 37708, 36873, 34849, 35352, 35965, 35737, 34245, 33348, 36783, 37222, 36056, 35151, 38337, 39482, 40632, 40600, 41576, 35938, 34690, 34716, 35699, 33569, 33434, 34570, 35372, 32154, 30958, 30618, 30185, 29506, 29094, 28708, 34763, 35812, 35260, 34098, 36974, 37601, 36400, 36088, 35573, 36608, 37767, 35232, 33866, 35253, 33546, 36292, 37320, 36740, 35552, 37876, 38986, 40280, 39014, 41057, 40324, 37526, 37025, 35667, 34782, 37014, 38393, 38379, 39494, 35379, 34117, 32998, 31865, 33292, 32092, 32324, 33447, 31737, 30600, 30528, 31345, 29696, 31237, 31187, 30810, 29712, 30148, 29825, 31749, 31351, 31900, 32880, 31861, 33379, 33921, 35658, 31353, 31834, 33195, 33831, 30765, 31274, 30190, 29151, 30436, 33754, 35080, 35935, 35449, 34884, 36269, 37198, 36595, 38411, 37235, 38089, 37938, 37511, 39537, 40083, 38261, 38185, 39116, 40195, 38635, 38670, 38778, 38845, 39720, 41209, 41740, 39572, 38778, 41962, 43406, 43890, 45097, 42983, 43411, 43217, 42395, 42644, 42792, 43702, 41992, 43901, 42162, 43115, 43990, 43984, 43889, 44447, 45188, 45022, 46494, 46043, 43153, 43094, 44498, 45228, 42200, 40696, 39986, 38545, 38024, 38846, 36722, 44886, 46311, 46656, 47798, 46772, 46129, 45164, 46655, 45699, 45815, 44468, 43331, 44619, 43385, 42310, 42495, 43681, 42480, 41148, 40005, 40286, 39415, 39610, 39234, 37963, 37023, 37838, 41217, 41322, 40285, 39776, 42675, 42612, 39720, 38697, 39286, 38512, 37823, 36872, 35623, 34315, 40565, 41358, 41955, 42520, 42589, 42184, 41780, 42157, 41368, 41750, 41355, 40923, 41698, 42205, 43434, 43550, 41103, 39715, 44453, 45651, 46003, 45526, 46932, 47095, 46885, 48568, 46507, 46930, 47870, 48788, 47784, 47112, 46804, 47621, 48464, 49848, 50814, 47686, 46460, 50031, 51386, 51770, 52717, 52459, 50920, 51049, 49686, 48819, 49540, 48344, 48306, 49323, 48603, 49687, 50561, 47135, 46953, 47303, 47030, 45544, 45115, 47876, 48212, 46969, 45874, 48965, 48361, 48168, 47073, 45958, 46479, 47383, 45226, 43901, 43413, 42027, 42031, 45984, 46462, 45410, 44291, 46729, 47200, 47794, 45816, 44735, 44968, 46152, 44630, 44360, 43921, 43932, 42662, 41562, 44006, 43487, 41992, 41514, 41290, 42794, 41583, 41307, 41962, 41596, 42663, 42152, 41571, 42269, 40126, 39656, 40737, 41268, 38380, 37937, 36891, 36234, 36700, 41181, 42328, 43669, 43862, 42253, 42227, 42191, 43227, 44554, 44700, 46053, 46716, 47369, 46903, 46837, 48084, 48215, 48840, 46661, 47319, 46379, 45415, 47977, 48843, 48742, 46719, 45926, 46570, 47763, 45880, 45541, 44039, 43448, 41954, 45772, 46328, 45841, 44680, 46015, 45710, 44791, 46706, 46453, 46729, 47875, 47396, 46930, 47596, 48073, 45678, 45842, 45337, 45007, 45152, 43671, 43034, 43176, 45290, 44683, 44818, 45506, 43201, 42514, 44205, 44305, 43088, 43141, 44340, 43693, 45823, 42011, 40752, 40871, 40339, 39628, 40004, 38366, 41593, 41793, 42573, 42522, 42537, 43859, 43362, 44184, 43487, 44128, 45409, 42205, 41380, 41413, 41855, 39956, 38947, 39080, 38807, 39509, 41062, 41175, 42509, 42541, 40960, 39644, 38482, 37105, 43639, 44938, 45008, 45969, 46085, 46163, 47552, 45709, 44106, 44128, 44030, 43196, 43089, 42854, 42064, 40969, 42632, 44928, 44928, 45773, 46198, 46124, 46845, 48307, 49148, 46822, 45222, 48718, 50161, 50802, 52016, 50324, 49087, 50517, 49963, 50511, 49642, 48429, 50577, 51623, 50905, 52010, 50238, 49334, 49673, 50826, 49437, 48474, 47125, 48892, 46139, 47919, 46570, 48751, 48963, 48464, 47245, 48091, 48897, 48257, 48951, 47889, 49397, 49038, 50161, 51307, 49813, 50750, 50207, 49015, 50942, 51426, 52331, 50769, 51143, 50860, 51377, 52545, 51530, 50995, 51924, 49565, 50516, 50869, 50568, 49365, 49894, 49960, 51319, 48834, 51566, 51241, 51367, 52489, 52085, 51895, 51612, 53152, 50273, 50283, 49581, 48409, 49499, 49493, 48711, 50350, 50213, 49537, 50032, 51136, 49826, 49224, 49355, 49687, 49181, 49567, 49233, 50115, 48903, 48932, 49289, 48040, 47838, 48852, 46674, 47953, 47484, 48058, 48019, 45980, 48685, 49385, 49303, 50267, 48146, 48017, 49160, 50345, 46689, 45544, 45595, 44508, 48762, 49740, 49237, 48390, 49915, 51351, 51931, 51932, 49527, 49101, 50357, 51099, 48354, 49158, 47252, 49634, 50739, 52008, 51968, 52935, 53201, 50877, 50601, 49196, 48966, 50667, 51271, 48409, 47109, 47319, 46787, 46300, 46105, 45121, 43911, 45517, 48237, 48596, 49130, 48739, 49697, 49397, 50577, 48127, 49959, 50591, 49652, 49913, 51714, 52607, 53374, 54320, 53078, 48462, 47403, 46580, 45336, 46498, 45292, 45352, 44092, 47173, 46411, 47375, 46820, 45854, 44534, 44438, 43351, 43224, 42130, 42051, 48676, 49630, 50831, 51772, 50096, 48933, 49448, 50999, 50783, 51965, 52189, 53299, 51159, 51256, 51727, 51962, 49949, 50020, 48680, 51106, 51677, 52088, 53533, 54358, 51912, 50418, 52416, 50351, 53866, 55241, 55751, 56951, 55353, 55769, 54834, 55244, 53799, 54838, 55236, 54233, 53003, 55540, 55261, 54844, 54855, 54092, 54510, 55718, 54390, 53896, 53849, 53561, 53914, 54339, 55334, 52799, 51744, 52194, 53704, 54073, 55204, 56261, 55004, 55973, 55368, 54127, 56343, 55219, 54842, 54465, 53779, 53402, 53068, 51997, 56216, 55798, 56194, 57358, 56502, 55883, 56437, 55188, 55419, 54979, 53791, 54707, 54473, 55317, 54402, 53937, 55974, 55742, 55837, 56942, 56804, 57111, 56277, 56037, 54721, 54782, 53866, 52661, 54213, 54203, 53357, 51974, 50962, 51074, 49719, 54342, 53555, 53113, 52030, 52300, 52610, 51676, 53765, 52247, 53515, 53875, 53456, 54072, 55040, 53837, 52558, 53577, 54173, 53937, 54899, 53699, 54182, 55502, 53393, 55533, 54274, 52819, 52488, 53473, 53206, 51133, 54517, 55243, 56687, 57248, 55241, 54037, 54373, 53305, 57275, 58675, 59518, 60751, 58727, 60073, 57949, 58818, 59465, 58497, 57299, 59706, 60298, 59012, 58129, 58036, 57700, 58630, 58736, 59428, 57384, 58401, 58431, 57085, 56943, 59052, 58061, 55936, 54643, 54467, 53592, 53596, 53629, 52807, 54515, 52842, 54546, 53716, 55305, 55395, 56392, 57507, 55812, 54800, 55643, 53657, 55862, 56509, 56863, 57960, 55521, 56162, 56955, 57687, 58933, 55986, 56352, 56892, 57223, 55154, 54978, 53972, 55965, 56893, 57374, 58754, 59777, 57359, 57422, 56112, 57796, 58874, 60155, 60544, 61728, 60222, 58907, 58817, 57926, 58380, 59645, 57548, 59578, 59942, 59022, 57788, 60411, 59577, 60157, 59696, 59675, 58976, 59381, 60595, 59303, 58862, 58696, 59515, 58423, 58712, 59019, 59788, 57531, 57363, 56187, 58625, 58423, 58715, 58155, 58657, 57033, 56386, 55784, 55652, 55310, 55779, 55192, 53966, 56014, 55449, 55018, 55732, 56282, 53550, 53225, 51719, 50924, 51201, 56256, 57153, 56744, 55858, 58609, 58909, 60301, 60840, 60943, 57195, 56889, 57809, 58872, 57011, 56235, 57095, 54968, 57319, 58116, 59515, 59706, 57475, 56095, 54951, 55213, 53786, 60470, 61870, 62449, 63615, 61537, 61912, 62100, 62891, 63084, 62541, 61313, 63251, 61116, 61199, 60288, 59092, 60957, 62056, 61854, 63356, 62885, 64428, 64148, 65181, 60917, 60131, 59813, 58792, 60894, 60899, 60685, 60595, 60829, 61918, 61581, 61358, 60273, 62157, 59985, 61824, 60745, 59818, 59782, 59232, 58103, 58871, 59006, 59815, 58390, 59993, 58560, 59350, 59492, 60158, 59874, 60092, 61277, 60880, 60464, 61041, 59113, 59259, 58375, 57173, 59036, 58649, 59879, 57589, 58973, 58215, 57619, 56385, 57073, 56477, 55577, 56948, 58495, 58158, 58816, 59982, 58512, 57619, 56394, 58409, 58055, 58582, 59224, 60287, 57567, 57405, 55991, 55421, 55411, 58681, 59196, 59945, 60344, 57959, 57430, 58304, 56175, 59990, 60550, 61995, 62909, 60388, 60283, 58939, 60608, 62225, 63558, 64252, 65476, 63331, 63962, 63146, 63455, 62158, 63389, 63948, 63008, 61783, 64314, 63150, 63430, 64502, 62444, 63580, 62844, 62357, 61299, 63803, 64237, 65325, 63069, 63140, 63090, 64389, 65448, 62953, 61624, 60517, 61243, 59467, 59897, 61917, 59160, 61199, 59857, 64418, 65668, 66607, 66672, 65343, 66417, 67625, 65979, 67588, 68588, 69517, 70709, 69409, 68509, 68622, 67346, 67617, 66813, 66710, 65662, 65573, 65051, 69063, 69861, 68906, 69224, 70365, 71612, 72285, 71854, 67709, 66671, 65840, 64823, 65805, 66073, 65151, 65749, 66774, 64140, 62950, 61688, 60660, 60583, 61441, 59616, 65081, 65556, 64468, 63374, 66240, 67242, 68429, 66821, 64793, 63872, 64599, 65809, 63250, 62553, 61205, 62445, 63903, 64461, 63565, 62354, 64676, 65746, 65102, 64245, 63562, 64017, 65179, 63854, 63489, 63128, 63547, 63182, 63502, 63910, 64876, 62210, 62536, 63124, 63402, 63078, 62168, 62520, 63690, 63454, 64524, 65370, 64406, 65317, 64575, 63337, 66358, 65855, 66691, 66151, 67032, 65352, 64734, 65064, 66137, 65185, 65880, 65636, 67366, 64169, 64387, 64065, 62974, 63471, 63430, 64501, 62321, 64429, 62241, 63292, 63361, 64971, 64700, 64730, 65762, 65657, 65264, 65685, 64417, 65291, 64023, 64454, 63713, 63793, 62846, 61628, 63562, 63398, 62621, 62146, 60991, 61430, 61909, 61987, 62345, 62496, 62833, 62928, 63024, 62960, 64069, 65233, 63276, 62401, 61147, 63101, 63777, 64776, 65283, 66486, 64084, 62623, 62423, 64487, 64907, 65482, 65477, 63721, 62810, 62448, 63374, 64748, 65859, 66162, 67585, 67861, 65250, 65748, 65362, 65276, 68488, 69916, 70119, 69665, 70644, 71303, 70953, 71149, 71711, 71724, 72022, 71413, 73365, 72361, 72927, 71972, 72328, 73499, 74860, 70771, 69753, 69485, 69696, 68485, 68560, 68560, 67522, 69688, 69262, 69038, 70166, 70017, 68933, 67719, 68915, 67555, 71384, 72543, 72634, 73321, 73822, 74006, 73821, 74401, 73977, 74575, 74359, 74542, 72017, 72043, 70986, 71292, 71748, 71815, 73279, 73472, 73258, 72872, 73371, 69791, 68703, 69170, 68992, 67522, 66426, 64925, 63681, 69811, 70469, 71219, 71083, 71506, 70967, 72149, 73224, 72050, 72120, 72873, 71886, 71858, 73916, 73956, 75004, 74928, 75941, 71095, 70129, 69253, 69165, 69217, 68214, 70073, 68506, 67516, 68184, 67490, 66565, 67283, 65526, 69496, 70164, 69864, 70254, 69387, 69169, 70415, 70543, 68027, 68385, 66659, 71481, 72757, 73396, 73986, 73708, 74938, 75942, 75475, 76431, 73453, 74167, 73204, 73650, 71908, 70945, 70446, 69424, 69740, 69695, 68314, 68395, 67357, 66117, 67596, 71114, 70646, 71359, 72569, 70875, 69576, 69028, 67822, 69907, 70554, 71148, 71706, 71744, 70118, 72052, 72524, 71779, 71901, 73997, 74734, 73841, 73786, 73090, 70734, 69786, 68844, 67993, 68981, 68174, 68274, 67369, 68552, 68169, 67385, 68595, 69527, 69822, 70591, 71772, 70502, 69621, 70663, 70329, 69915, 70642, 70824, 69974, 69982, 68786, 68977, 67622, 71917, 72351, 72053, 72381, 73845, 74485, 74352, 71304, 70935, 69553, 69303, 71179, 69975, 70561, 70719, 69757, 68572, 70001, 68583, 67311, 66854, 65750, 66127, 66143, 66279, 65976, 67668, 67485, 68385, 69629, 67873, 66736, 65633, 67098, 67813, 68658, 69269, 69603, 69109, 69543, 69301, 70089, 68818, 67430, 66620, 66637, 66003, 68187, 67997, 67934, 67025, 66733, 65912, 64739, 63638, 62412, 61997, 61523, 68879, 68906, 70379, 71219, 68147, 70720, 72095, 72510, 71957, 72247, 73294, 73531, 73960, 75205, 75128, 74171, 73032, 76306, 77572, 77461, 78556, 78149, 74461, 74108, 74702, 75108, 74494, 74752, 75264, 75030, 74647, 76731, 75304, 75164, 73947, 73508, 76492, 77627, 79003, 79777, 79328, 73188, 71990, 70701, 70744, 71930, 73128, 72968, 74310, 74136, 69585, 68356, 67509, 66709, 67529, 67860, 69154, 67707, 67543, 66822, 67645, 68568, 65390, 64766, 65319, 63291, 67499, 68335, 67711, 66601, 69753, 70035, 68389, 67874, 67773, 66747, 68683, 70162, 71045, 70404, 72289, 68738, 68736, 67436, 67018, 69887, 70232, 71545, 72610, 71452, 66661, 65347, 64211, 63042, 64976, 66008, 66563, 66399, 64513, 63426, 63355, 62560, 63677, 62788, 63243, 62967, 64318, 64424, 63610, 62484, 65910, 66105, 65342, 67128, 64012, 7102, 7338, 6225, 5869, 5529, 5321, 9020, 9390, 7699, 6725, 4821, 6648, 6364, 9774, 15283, 15297, 16704, 17669, 17507, 17893, 13569, 12728, 14608, 16696, 19020, 16121, 18940, 13242, 19974, 21307, 22303, 22157, 20763, 20581, 21050, 23652, 23258, 20279, 19848, 21195, 22183, 21638, 20226, 19571, 22009, 22492, 21608, 23379, 22457, 19463, 19283, 21960, 11058, 11751, 12134, 10771, 10160, 8852, 13021, 14239, 12898, 12761, 10834, 9918, 7704, 12267, 46037, 46983, 46505, 46251, 45186, 44685, 47997, 47981, 46944, 47494, 45811, 45732, 45840, 49004, 45800, 46952, 48240, 48170, 46986, 46710, 46952, 49369, 47896, 45846, 46770, 46284, 47323, 48421, 48873, 49664, 44001, 42667, 44891, 46803, 49484, 47718, 50315, 44145, 50033, 51530, 52145, 51287, 49944, 49142, 51675, 53427, 51767, 49442, 48969, 54453, 55765, 56204, 56221, 54800, 54316, 56817, 57492, 56669, 54574, 55246, -7808, -7921, -7873, -6555, -8978, 19753, 19128, 20027, 21006, 18792, 11240, 12213, 10329, 11860, 10278, 24844, 24843, 23581, 26084, 24953, -2303, -1058, -2509, -2393, -3446, 35758, 35013, 34996, 37237, 35809, 27365, 26039, 27608, 28467, 27245, 53228, 54400, 52266, 53674, 52396, 6904, 18998, 21003, 5721, 24854, 57695, 37781, -9070, 20885, 19708, 1927, 4902, -835, 17207, 34914, 39983, 40726, 2355, 68108, 54257, 4470, 50249, 9061, 42560, 51393, 13599, 10244, 61633, 19862, 38520, 48814, 16122, 27888, 49001, 51272, 18776, 58861, 21639, 44871, -1791, 714, -1176, -5156, 37335, 40030, 7987, -14058, 32779 }, z { 67159, 67081, 66350, 65784, 66300, 65162, 64321, 64795, 63270, 66375, 65604, 64139, 63852, 66160, 67663, 65484, 68498, 63196, 61773, 61302, 61690, 60999, 61674, 60580, 60003, 58869, 58884, 58048, 58083, 57354, 57396, 57474, 56683, 56860, 56795, 56350, 55529, 54753, 55788, 55141, 53977, 54195, 55933, 57067, 54988, 57668, 52751, 51631, 50992, 50330, 50651, 49600, 49096, 49251, 51321, 50939, 49794, 49832, 52077, 53364, 51653, 53286, 48812, 47600, 46492, 46281, 47023, 45952, 46264, 45284, 45498, 46666, 44602, 45629, 44494, 44915, 44347, 43671, 42829, 42403, 42587, 45878, 46263, 47758, 48711, 45758, 44314, 43457, 43989, 48036, 49397, 50198, 51354, 49409, 50721, 51248, 51457, 52450, 52661, 53160, 54358, 49594, 50218, 50753, 51644, 49219, 48686, 47754, 46573, 48361, 50349, 50834, 52258, 52940, 49911, 48648, 48428, 49184, 47211, 52688, 54019, 55039, 56235, 54159, 53707, 53790, 54545, 54560, 55404, 55852, 56933, 54737, 54831, 53387, 53426, 52554, 55201, 55676, 57077, 57644, 54704, 53333, 52269, 52650, 52021, 50943, 52555, 57632, 58794, 59912, 61030, 58674, 57608, 57852, 57495, 59652, 60679, 61989, 62937, 59982, 59272, 58757, 58722, 58420, 62207, 63454, 64108, 65303, 63290, 62796, 63122, 61890, 63351, 63879, 65021, 65069, 62690, 61148, 66137, 67204, 67116, 67481, 68593, 68822, 68838, 66689, 66442, 65043, 64791, 67456, 67082, 68886, 64203, 62882, 62941, 63213, 61853, 61705, 60542, 60471, 63042, 63226, 61869, 61181, 63856, 64115, 65013, 64489, 66182, 61582, 60320, 59893, 60775, 58604, 58253, 57697, 57383, 57217, 55962, 55116, 55606, 53967, 54428, 53652, 52464, 57445, 56803, 55616, 55806, 57856, 57242, 56469, 58290, 54395, 53197, 52714, 52541, 52027, 52046, 51128, 52907, 51444, 52539, 52584, 51992, 50755, 50827, 53063, 54335, 52651, 55473, 49556, 48380, 47353, 47186, 47603, 47562, 46673, 48960, 46497, 45197, 45287, 44538, 44182, 44164, 43298, 43644, 46254, 46540, 46408, 46856, 47963, 47967, 48600, 49439, 46013, 45922, 46537, 45909, 44469, 44498, 47740, 48421, 47753, 47451, 49885, 50775, 51887, 51492, 52506, 47615, 46986, 47995, 49012, 46327, 47622, 48484, 48821, 49924, 47858, 48814, 47852, 47980, 49105, 50224, 46652, 45948, 45623, 45718, 48818, 49802, 51100, 51183, 49130, 49887, 49228, 51254, 49910, 51976, 51276, 51893, 52218, 53546, 53947, 53057, 54599, 54814, 54919, 55221, 55604, 56687, 57538, 56147, 57426, 56676, 57635, 58925, 59030, 56965, 55727, 55406, 54870, 54274, 53728, 53432, 52305, 59825, 61039, 61845, 62320, 61760, 63244, 63986, 65403, 66395, 66132, 67628, 62139, 62863, 64203, 64475, 61978, 60554, 59998, 59728, 58672, 58406, 57867, 65211, 66560, 67233, 68443, 67380, 66514, 65132, 66676, 67362, 67195, 67952, 66852, 65902, 65891, 67147, 66874, 66053, 65800, 66807, 66863, 64389, 63787, 63878, 62294, 67673, 68574, 68321, 68837, 70034, 70225, 70529, 67605, 67418, 66048, 65431, 68503, 68208, 69913, 65415, 64133, 64431, 64922, 63152, 62671, 61978, 61815, 64238, 64719, 63863, 64242, 64939, 63781, 66134, 62639, 61785, 61388, 62386, 60483, 60834, 59697, 58556, 59931, 60102, 59713, 59142, 58678, 58636, 57388, 56305, 57307, 55086, 56124, 55032, 53847, 59004, 58454, 57238, 57427, 59510, 58818, 58040, 59705, 56035, 54799, 54008, 53547, 53949, 52416, 51821, 51985, 53800, 53034, 51838, 51969, 53916, 55026, 56417, 55039, 50642, 49467, 48379, 47934, 49102, 47692, 46697, 47326, 45396, 46011, 45037, 47944, 46815, 47049, 46232, 45427, 45121, 43706, 42806, 42036, 41931, 41327, 48023, 48341, 48368, 49072, 49751, 50296, 49893, 47659, 47749, 48386, 48670, 46364, 48849, 49385, 50872, 51604, 51383, 52805, 53323, 52837, 53027, 54443, 55416, 54246, 54190, 54749, 56163, 56600, 54734, 53293, 53128, 54132, 51978, 56761, 58060, 58432, 58374, 59139, 60429, 58984, 59405, 60734, 60927, 59498, 58402, 58512, 56994, 61583, 62799, 62445, 63287, 61309, 60738, 60596, 60903, 59361, 59311, 60320, 58187, 60247, 60048, 61350, 61851, 58945, 57494, 56565, 57113, 61869, 63046, 64219, 64837, 62700, 61390, 60384, 61130, 59159, 59895, 58896, 64767, 65899, 67126, 68159, 66246, 65717, 64411, 67231, 68401, 68135, 69104, 68962, 69761, 70979, 69169, 66978, 66730, 67817, 68081, 65292, 64882, 64962, 63478, 68582, 69683, 69602, 70077, 70952, 70880, 72253, 69073, 68892, 67494, 67022, 69955, 69934, 71366, 66796, 65592, 66000, 66274, 64491, 64277, 63208, 63478, 66230, 67021, 66225, 66664, 67461, 68058, 68908, 69773, 71064, 71610, 71941, 64884, 63950, 64063, 63674, 64304, 64336, 62986, 62961, 64845, 65164, 66113, 64433, 66054, 65002, 63370, 64543, 62876, 63470, 61895, 60573, 59917, 60237, 59689, 59470, 60306, 59898, 59092, 59207, 58600, 57104, 56368, 59092, 60632, 60954, 61297, 56594, 55182, 54993, 55278, 54795, 53357, 52447, 52914, 51104, 51538, 50672, 54763, 54650, 55716, 55487, 53303, 56924, 58056, 58556, 59580, 57700, 56797, 57119, 55552, 57800, 58222, 58891, 58495, 57000, 56453, 55199, 57200, 54704, 56705, 55445, 54886, 59979, 60670, 60216, 60577, 62157, 59597, 59323, 58021, 58001, 60471, 60188, 59571, 61393, 56875, 55628, 55114, 55117, 54553, 53261, 55042, 54822, 54280, 53027, 53205, 55296, 56500, 54821, 57675, 51845, 50591, 49557, 49203, 50110, 48865, 49025, 47620, 47938, 46534, 46687, 49001, 47954, 48313, 47587, 46583, 46250, 44757, 44082, 44573, 49482, 50088, 49745, 50523, 51584, 52420, 52401, 51108, 48602, 48273, 49186, 49361, 46868, 45892, 46516, 49493, 50285, 51763, 52501, 50001, 48599, 47688, 48408, 52182, 53621, 54275, 53772, 53851, 55269, 55598, 55344, 55213, 55779, 57122, 57691, 55995, 54788, 55127, 54027, 54489, 57645, 58861, 59201, 58437, 60059, 60624, 61012, 60714, 60129, 60340, 61114, 60841, 61006, 60092, 61207, 59948, 62192, 63121, 64024, 64899, 63913, 64771, 66194, 66979, 64294, 62835, 62610, 62644, 66779, 68071, 69214, 70375, 68264, 68369, 69587, 67322, 69749, 67479, 68688, 68997, 69068, 70223, 69947, 70592, 70363, 71268, 72454, 70767, 68882, 68621, 69691, 69837, 67213, 66612, 66646, 65146, 70563, 71605, 71540, 72223, 73018, 73165, 73248, 74413, 75621, 75800, 76577, 70637, 70590, 69310, 69050, 71695, 71777, 71168, 72637, 68576, 67469, 68009, 68243, 66307, 65558, 65374, 64642, 68350, 69145, 68332, 68831, 69579, 69738, 70855, 67019, 66180, 64783, 64430, 65951, 65543, 65529, 64450, 63266, 62868, 62494, 64283, 62983, 63001, 64005, 61894, 61833, 60957, 60687, 61223, 60557, 59771, 58521, 58532, 60591, 60684, 62036, 61407, 57501, 56247, 55791, 55406, 55169, 53816, 52992, 51770, 50720, 50696, 49789, 55886, 55555, 54398, 54664, 56760, 57874, 56449, 59176, 53190, 51935, 50944, 51090, 51216, 49969, 49578, 50414, 48488, 50096, 49242, 49611, 48749, 47718, 47411, 45982, 45622, 44196, 50665, 50976, 50974, 52033, 52381, 52345, 51583, 53056, 49772, 49542, 50529, 50890, 48156, 51005, 51920, 53353, 54026, 51477, 49958, 49608, 49207, 53685, 55047, 56007, 55743, 55145, 56378, 56948, 56104, 57110, 58089, 59426, 59446, 58100, 56639, 60509, 61827, 61789, 62369, 62130, 62519, 61582, 63817, 61980, 64200, 63270, 63730, 61180, 61090, 61935, 62839, 59634, 59108, 57859, 60170, 61843, 62703, 64158, 65025, 62239, 62402, 64432, 65753, 66445, 67499, 65719, 64924, 65005, 65985, 66661, 67179, 66531, 65714, 66352, 65110, 68367, 68967, 68872, 69888, 70342, 70983, 70685, 71964, 67704, 67410, 68367, 68497, 65930, 64906, 64188, 64517, 63394, 63579, 64873, 62954, 64285, 63336, 69171, 70081, 71292, 72134, 70603, 71424, 71549, 72526, 72113, 72874, 72741, 73371, 73975, 74560, 70807, 70144, 69679, 69966, 68901, 69347, 68176, 68165, 69193, 68651, 69285, 69311, 67259, 65878, 65323, 65334, 69518, 70003, 68946, 68939, 70381, 71834, 72521, 72208, 67900, 66773, 65775, 64517, 66092, 66219, 65377, 64352, 63292, 66120, 66855, 67068, 64626, 63692, 62309, 61359, 64305, 64684, 62165, 60978, 60259, 59194, 61399, 61717, 61149, 62585, 60793, 60126, 58817, 58855, 61033, 62217, 62369, 63000, 57785, 56489, 56051, 55797, 55421, 54078, 53648, 53195, 52392, 51951, 51564, 50318, 56116, 55935, 54830, 54757, 57171, 58469, 57093, 59389, 53873, 52755, 51874, 51637, 51881, 50881, 51047, 51402, 50278, 50835, 50176, 52116, 52746, 52687, 52055, 54187, 54152, 53269, 55019, 53272, 53195, 54169, 55360, 53433, 53832, 53100, 53558, 53040, 53731, 54489, 55659, 55501, 53455, 52099, 52315, 56859, 58128, 58155, 58768, 59099, 58602, 57094, 57489, 57295, 56446, 56732, 56647, 55982, 56451, 55934, 55753, 55389, 54742, 55541, 55361, 53294, 52567, 51093, 50701, 50376, 56355, 57183, 58196, 58414, 58001, 56808, 58977, 60029, 61120, 61699, 61596, 62533, 63855, 64377, 62750, 61410, 60480, 61363, 64524, 65853, 66805, 66634, 65806, 65092, 64489, 65951, 67849, 68740, 69493, 69575, 69657, 68703, 70059, 70851, 71850, 72615, 71557, 70690, 69903, 71843, 72745, 72223, 72547, 71314, 70828, 70353, 70617, 69705, 70420, 69092, 69617, 69024, 70032, 69835, 67896, 66542, 66255, 65086, 70967, 71986, 72959, 72921, 72766, 73841, 74781, 76025, 77145, 75208, 75560, 75302, 74096, 76282, 75769, 76848, 76226, 75810, 77517, 78886, 75932, 75361, 76236, 77456, 75456, 76515, 76395, 75596, 76378, 76189, 77034, 76038, 75706, 77094, 78471, 75095, 74938, 75670, 75928, 73459, 72432, 76031, 76538, 75472, 74234, 77027, 78465, 79116, 80016, 78721, 75880, 75081, 75204, 76282, 75450, 74870, 75622, 74720, 75134, 74034, 74077, 73189, 72414, 73553, 72127, 74362, 73173, 72182, 71137, 71509, 72833, 72819, 74313, 69866, 68777, 67882, 67394, 67904, 68724, 66716, 67966, 67537, 66713, 67141, 66326, 65292, 64244, 63150, 64522, 68433, 69007, 68719, 68383, 68540, 69093, 70280, 68213, 68862, 68850, 70010, 70213, 67524, 66702, 65294, 65049, 64389, 70952, 72097, 71832, 71889, 73359, 74620, 75237, 75194, 76407, 76366, 76973, 78146, 71493, 71193, 71560, 72213, 69709, 69498, 70304, 68295, 71393, 71698, 70762, 69567, 71514, 72630, 72237, 73978, 73193, 74916, 74535, 75328, 71366, 70577, 70461, 71406, 71233, 71234, 70003, 70039, 69017, 67864, 69197, 69294, 68997, 67665, 66665, 69167, 67827, 67583, 66325, 65407, 64198, 66564, 67203, 68525, 66480, 68678, 67422, 65141, 67088, 64789, 65745, 66005, 65161, 65858, 67001, 65162, 64613, 64282, 65331, 65946, 67213, 68135, 65082, 63734, 65148, 67253, 68443, 69285, 70426, 68068, 67126, 67553, 65863, 68913, 69691, 69821, 68905, 69074, 69285, 68279, 68203, 69276, 70498, 69180, 71063, 71619, 71692, 71724, 73110, 73346, 71690, 71690, 73162, 74041, 71196, 71435, 70733, 70033, 70912, 73524, 74934, 75477, 74946, 75185, 74482, 74523, 73684, 74158, 76698, 77413, 78770, 79116, 77537, 76536, 75912, 74171, 79565, 80892, 81989, 81761, 81000, 80312, 83206, 84304, 84431, 84507, 85503, 85198, 83702, 84546, 84750, 85836, 85803, 85129, 85566, 86908, 87963, 87429, 87834, 88618, 89016, 89759, 86446, 85817, 85195, 85017, 84769, 85535, 84806, 84323, 82886, 82082, 82624, 81364, 81270, 80415, 81214, 81002, 80723, 80471, 79152, 82079, 82044, 81337, 81176, 83432, 84131, 85625, 86377, 87330, 87600, 87950, 80968, 80355, 81451, 82616, 79541, 81065, 82043, 81448, 80216, 82504, 81402, 82311, 81913, 81226, 81318, 83188, 84091, 82745, 80882, 80364, 81467, 81159, 79914, 78526, 77670, 77687, 76939, 82739, 83886, 84486, 85664, 84966, 84672, 85551, 83443, 83607, 84048, 85228, 86117, 84373, 83102, 82054, 83268, 85157, 86255, 85690, 84632, 86744, 88233, 88832, 90066, 88079, 86313, 85740, 85521, 86300, 86648, 87098, 84540, 84202, 84786, 85166, 82695, 81747, 84675, 85128, 84289, 83103, 84810, 85267, 84550, 86340, 85178, 86258, 84711, 83879, 82607, 81731, 84742, 85910, 86082, 82561, 81381, 80319, 79251, 81804, 82397, 81501, 80248, 82141, 80735, 79838, 78819, 79133, 80572, 81251, 77520, 76533, 75912, 75813, 75462, 74305, 74895, 73420, 75681, 74978, 76058, 76057, 76760, 77660, 78377, 78163, 76787, 77461, 79189, 79964, 80484, 80423, 81146, 82261, 80883, 81318, 82826, 83326, 81105, 81818, 83548, 85004, 85395, 84711, 85649, 86359, 86575, 87177, 87393, 87556, 88175, 87115, 87347, 88057, 87907, 88652, 89541, 86899, 86596, 85251, 84117, 86608, 86362, 85302, 87427, 85305, 84143, 83221, 82322, 84446, 84986, 85473, 84941, 83511, 82734, 82158, 81444, 83529, 84335, 84518, 82476, 81845, 80709, 80335, 82943, 80226, 79157, 77869, 77642, 78775, 80302, 76978, 75654, 74735, 73874, 75242, 73886, 76071, 75187, 74385, 75390, 76455, 73331, 75058, 75875, 75452, 74368, 76063, 76538, 76396, 76338, 75740, 75009, 77712, 77854, 79087, 79269, 78617, 77533, 78901, 76190, 75821, 75122, 74003, 77011, 77647, 78425, 77556, 78759, 78232, 75769, 75259, 75892, 77111, 75426, 74417, 74904, 73065, 74089, 72233, 72766, 72017, 75077, 75555, 75793, 75150, 74548, 74954, 75817, 74421, 76173, 74781, 75644, 75905, 76821, 77172, 78165, 79350, 77785, 77941, 79197, 76864, 79400, 77020, 78301, 78435, 77642, 78440, 79170, 80413, 79428, 78393, 79028, 79861, 80776, 79791, 80635, 79873, 79309, 81774, 82566, 82682, 80036, 79471, 80228, 81321, 79370, 78266, 79731, 80462, 80057, 78936, 80088, 81053, 80506, 80913, 80575, 79795, 79137, 81928, 82765, 82320, 79901, 79124, 78974, 79616, 79746, 78072, 77907, 79076, 79250, 76511, 75226, 79599, 80599, 80050, 78870, 80975, 80077, 79207, 80887, 80493, 79671, 79928, 81826, 82754, 82363, 78716, 77716, 76788, 76326, 78456, 79371, 80379, 79051, 76692, 75780, 75078, 75509, 76466, 77237, 77424, 73832, 73024, 72315, 72021, 71931, 72564, 72815, 72923, 73415, 73536, 73779, 74387, 72126, 71426, 69979, 69302, 71452, 72588, 72683, 71455, 71530, 72668, 70533, 69549, 68183, 67621, 68186, 68151, 66773, 65753, 66573, 64509, 65320, 64281, 66468, 65805, 66600, 66511, 65472, 64314, 63075, 62517, 62626, 67449, 68303, 69319, 69746, 69611, 70566, 71509, 72146, 69764, 69028, 67779, 69498, 67469, 68489, 70692, 68620, 70815, 69784, 71435, 72095, 72271, 71541, 71367, 70203, 69819, 68444, 67895, 68653, 66638, 73317, 73628, 73183, 73320, 75138, 75797, 72564, 71982, 72373, 72540, 70444, 70024, 69729, 72711, 73098, 71839, 70772, 73953, 73394, 74187, 72313, 71918, 70906, 70010, 68797, 71491, 70326, 70843, 71689, 71101, 69801, 71946, 70468, 69606, 68771, 67616, 70154, 70081, 69176, 71071, 69299, 68489, 67338, 66144, 69256, 68385, 68263, 67686, 67424, 66856, 66715, 67713, 66728, 65747, 64536, 67379, 66459, 66285, 65415, 64539, 63640, 66172, 64699, 63928, 63135, 62804, 64847, 65031, 64081, 66144, 62766, 62134, 60651, 60252, 62304, 63553, 61246, 64005, 59918, 58516, 58355, 57245, 57799, 57864, 57645, 56928, 59430, 59534, 58610, 58246, 60955, 61074, 58320, 57343, 55921, 55029, 57584, 55651, 54349, 54083, 54903, 54135, 54314, 55057, 55838, 54837, 52799, 52254, 51789, 50635, 51173, 49835, 52685, 52308, 52318, 53334, 53170, 52451, 51204, 50915, 51529, 51510, 49400, 48931, 49701, 47671, 52118, 52734, 54117, 54709, 52885, 51791, 54540, 55921, 56827, 56355, 56208, 55218, 55793, 57034, 55146, 57962, 58727, 59829, 60135, 60516, 61625, 62608, 62879, 62386, 61671, 60377, 62313, 59760, 61672, 60402, 63161, 64113, 65400, 65515, 63567, 62230, 63570, 66477, 67681, 68060, 68327, 68849, 68724, 70150, 69806, 67864, 68173, 69074, 69027, 66901, 67079, 67307, 67096, 67437, 67309, 70059, 71001, 71594, 71576, 70338, 70294, 69835, 70652, 71924, 72506, 71537, 72039, 70251, 69371, 68335, 67896, 68876, 67839, 67149, 67533, 66286, 68138, 67188, 65883, 65831, 67529, 66260, 64933, 63720, 62608, 62672, 63847, 63691, 64677, 64753, 61428, 60232, 59720, 59064, 59242, 57864, 56812, 56910, 55799, 60056, 59571, 60540, 61444, 58245, 57650, 57460, 56943, 57811, 60500, 61332, 60994, 59936, 61111, 61645, 61993, 61899, 60781, 60631, 63267, 64153, 63311, 60143, 59140, 59173, 58059, 58975, 57785, 60247, 59868, 60479, 60772, 60742, 61262, 60240, 59327, 62523, 63637, 64629, 63712, 65678, 64755, 65744, 60557, 59748, 60673, 61759, 58799, 57795, 59507, 56669, 60298, 61048, 61190, 60173, 60286, 60515, 59451, 59404, 58646, 57944, 58596, 62422, 62574, 61929, 61742, 64017, 64728, 64235, 65909, 61562, 60593, 59848, 60187, 58766, 57975, 58836, 59607, 56757, 56014, 58940, 59634, 61111, 61908, 59083, 57664, 57130, 57845, 55782, 61624, 63043, 63442, 62553, 63313, 64700, 64621, 65105, 65703, 66014, 66153, 65680, 66881, 66508, 65742, 66297, 65269, 64226, 67042, 68351, 68350, 69570, 69503, 70748, 70693, 71751, 65537, 64684, 65194, 66343, 64483, 63683, 64364, 64754, 63806, 62670, 64779, 63402, 65861, 63108, 64385, 63675, 62525, 62737, 64681, 65951, 65839, 61408, 60254, 60345, 59785, 59046, 58563, 60854, 60804, 59370, 58762, 61393, 58775, 57416, 56769, 57490, 55497, 54777, 54860, 54997, 53369, 53490, 54637, 55073, 55248, 53908, 52820, 55669, 57371, 53967, 52787, 52010, 52546, 53281, 54628, 55194, 50712, 49812, 48432, 47776, 49595, 48920, 48378, 47787, 46478, 48054, 46871, 45837, 46060, 47074, 45796, 48141, 44718, 43739, 42583, 42343, 43330, 44751, 42075, 41034, 40194, 40708, 41595, 43014, 43097, 42561, 43697, 38904, 38094, 37190, 37217, 37458, 38031, 38185, 37179, 39233, 36568, 35674, 34666, 34613, 34970, 33807, 32886, 33252, 31780, 33888, 33004, 33703, 34718, 31855, 30527, 29314, 28261, 28929, 33180, 33692, 33525, 34431, 33008, 33564, 33374, 31924, 31067, 32323, 32091, 32234, 31477, 30711, 30577, 30561, 33211, 33445, 32548, 32680, 34904, 35223, 35086, 36324, 36236, 31610, 30733, 31117, 30991, 29266, 28635, 29139, 31732, 32276, 31186, 30758, 33462, 34699, 33799, 35739, 30524, 29377, 29693, 28867, 28128, 28382, 27636, 29348, 30976, 31459, 32941, 33537, 31083, 32282, 33545, 35016, 35638, 36704, 35343, 36681, 35319, 34878, 35284, 35323, 36206, 34314, 33634, 35104, 34332, 34215, 35387, 35520, 32900, 32933, 36111, 37191, 38538, 39599, 37269, 38523, 39713, 40653, 41804, 39293, 40383, 41048, 40391, 42308, 40153, 40826, 41471, 42612, 39772, 39050, 39185, 38231, 40887, 41531, 42881, 43661, 40623, 39238, 38692, 39403, 43112, 44343, 45594, 45782, 44250, 45522, 45291, 44718, 45764, 46546, 47790, 47812, 48889, 46676, 46528, 46910, 46503, 45086, 44248, 47580, 47811, 46844, 46710, 49264, 49634, 50193, 46254, 45445, 44229, 44469, 46183, 47294, 45163, 48028, 43042, 41880, 41280, 40966, 40877, 39738, 39951, 38525, 39023, 37551, 37787, 41379, 40831, 39391, 39127, 41519, 41981, 41617, 40592, 39938, 38502, 37080, 36427, 36881, 35289, 34543, 34357, 34119, 33211, 33357, 34156, 32529, 34413, 34151, 32758, 32460, 35153, 36598, 37417, 36669, 31904, 30625, 30705, 30779, 29585, 28221, 27627, 27367, 30862, 31044, 29688, 29200, 32076, 33452, 32195, 34337, 29094, 27737, 27755, 27398, 26797, 25310, 24784, 24467, 28315, 28460, 27476, 27635, 29876, 30915, 30047, 32317, 26550, 25573, 26021, 26239, 24240, 23918, 22500, 21777, 20496, 19843, 19877, 26234, 26601, 27953, 28855, 26633, 28039, 29272, 29763, 29596, 30346, 30908, 31931, 31739, 31624, 30928, 30625, 30683, 33099, 34159, 35007, 35886, 34945, 35003, 36088, 33859, 34510, 35138, 35706, 34997, 34151, 33070, 33489, 31915, 36915, 37450, 38970, 39690, 37006, 39386, 40780, 40965, 41964, 41112, 42361, 39905, 39820, 39804, 40637, 38616, 38316, 37169, 37310, 36082, 38966, 38839, 40174, 40551, 37808, 36311, 35519, 35905, 40822, 42061, 43255, 44134, 42478, 43486, 44376, 43976, 45595, 43202, 44173, 43870, 43905, 44095, 45006, 46224, 44444, 43066, 42506, 42440, 42354, 41170, 41142, 40982, 41267, 40951, 41249, 41095, 42319, 41964, 42867, 42901, 40493, 39471, 37732, 37791, 43683, 44504, 45620, 46156, 45925, 47021, 46685, 47618, 47834, 49031, 49700, 50038, 45372, 44873, 45178, 44626, 43352, 43058, 42757, 41581, 46015, 46248, 45314, 45182, 47678, 48735, 49947, 50765, 50009, 44852, 44078, 42957, 43172, 44911, 46387, 44310, 41816, 40651, 40388, 40288, 39407, 38123, 39678, 40431, 40284, 38851, 38697, 40653, 39695, 42039, 37870, 36470, 35955, 36615, 34800, 34205, 34150, 34088, 32805, 31812, 31077, 31606, 30175, 30720, 30007, 29166, 33814, 33639, 32234, 31888, 34610, 34484, 36043, 31461, 30117, 29939, 30006, 29174, 27770, 26750, 25986, 24680, 29572, 29334, 27834, 27235, 30048, 31481, 29932, 32491, 27221, 25744, 25246, 25499, 25148, 23646, 23116, 23263, 23490, 23616, 23631, 24373, 23885, 24913, 24795, 23266, 22084, 21469, 21411, 20465, 20408, 26013, 27139, 27046, 27694, 28400, 28816, 26058, 25717, 26760, 27280, 24348, 23338, 23156, 22472, 22214, 21810, 27427, 28621, 29768, 30726, 29150, 29762, 30968, 30896, 29849, 31350, 31667, 32043, 32834, 32015, 31940, 32845, 32720, 32376, 32571, 31365, 33757, 34742, 35179, 34976, 36000, 37091, 35831, 36274, 37811, 38595, 35784, 34271, 34154, 33619, 38285, 39690, 40412, 41596, 39816, 39261, 39792, 40356, 40895, 41728, 39287, 38012, 37764, 37004, 36570, 35817, 35579, 40510, 41109, 42243, 42364, 40276, 39114, 37934, 39565, 43192, 44415, 45366, 45907, 45077, 46119, 45441, 46460, 45899, 45513, 46410, 45786, 46479, 47314, 48396, 49096, 48578, 44438, 43795, 44245, 43877, 42288, 41459, 41689, 40041, 44982, 45434, 44633, 44465, 46928, 47415, 48944, 49410, 49598, 49383, 50012, 44219, 43379, 42311, 42286, 44329, 44667, 43954, 46179, 41199, 40042, 40003, 40040, 38724, 38829, 37574, 37765, 40067, 40344, 39080, 39139, 41054, 42554, 43217, 43300, 37972, 36702, 36624, 35803, 37272, 37243, 35858, 35345, 38323, 39636, 40873, 40890, 41754, 35157, 33766, 32973, 33598, 33532, 32050, 31807, 32705, 30745, 31780, 31016, 29563, 29139, 31155, 32542, 32751, 31683, 33934, 28860, 27443, 26672, 27177, 26949, 27861, 28221, 27149, 25531, 24570, 24450, 24184, 23174, 23106, 23592, 24244, 23301, 24902, 24897, 26308, 26491, 27272, 28675, 29299, 30218, 28874, 28722, 28677, 28592, 29058, 29540, 30714, 30511, 28399, 27373, 26064, 27709, 25157, 26830, 25555, 24604, 31763, 32931, 32804, 33336, 34261, 34504, 32196, 32146, 30720, 30126, 33139, 33328, 34089, 32748, 34312, 32965, 33739, 30096, 28663, 28349, 28730, 27972, 26503, 26052, 25584, 24722, 24242, 23830, 22481, 27779, 27603, 26182, 25804, 28440, 28472, 29841, 25383, 23977, 23482, 23799, 23096, 21586, 20753, 21244, 22565, 21975, 23021, 23212, 21120, 20156, 19333, 20180, 23746, 24776, 24541, 24882, 26212, 26579, 26796, 26558, 23877, 23421, 24458, 24113, 22744, 21257, 20840, 21312, 19971, 25633, 26632, 27800, 28627, 27093, 25860, 25229, 25431, 28001, 29179, 29353, 28681, 29148, 30460, 31136, 30082, 30469, 30796, 31888, 32068, 31262, 30316, 30340, 31194, 29440, 32734, 33756, 34052, 33942, 35049, 35887, 37389, 37962, 38222, 34751, 35334, 36734, 36892, 35260, 33772, 33677, 32860, 37690, 39097, 39429, 38808, 39933, 39737, 40459, 38784, 40032, 39002, 37764, 38249, 37026, 37263, 40551, 41068, 41607, 42811, 42151, 42306, 42297, 42454, 40846, 41291, 42420, 42504, 40063, 39047, 37694, 39322, 37111, 38081, 40506, 37982, 40392, 39133, 43393, 44496, 45693, 46743, 44262, 43409, 43207, 42955, 45460, 46451, 46459, 47185, 46133, 45577, 45400, 45048, 44410, 44297, 44921, 44113, 44607, 44279, 43469, 44770, 45453, 45173, 44654, 45151, 46388, 45947, 46240, 45253, 43650, 42947, 42485, 42370, 41768, 40704, 41197, 39486, 42424, 42131, 41218, 41317, 43385, 44157, 43162, 40288, 39291, 39568, 39291, 37864, 37729, 36806, 36338, 40270, 40689, 39523, 39527, 41248, 42434, 38438, 37281, 35994, 35998, 37365, 34895, 33607, 33294, 34114, 32138, 31759, 31155, 31036, 30833, 29429, 28765, 27441, 26284, 30771, 30186, 28728, 28247, 30949, 32272, 33517, 33690, 28104, 26765, 26698, 27135, 25831, 24428, 23511, 24005, 22253, 22722, 21872, 20552, 26100, 25910, 24440, 23812, 26730, 28177, 29132, 28544, 30440, 29845, 30801, 23936, 22607, 22366, 22557, 21555, 21618, 21070, 22126, 22215, 20180, 18912, 18751, 17871, 17567, 16725, 16549, 23049, 24112, 23835, 24237, 25449, 25654, 25714, 25732, 22968, 22605, 23735, 23744, 21446, 21606, 22372, 24774, 25865, 27071, 28152, 26360, 25196, 24996, 24021, 24614, 26862, 28017, 27878, 27201, 28237, 29370, 30734, 29123, 28492, 28406, 28810, 29831, 29214, 28086, 28102, 28358, 29757, 30388, 27310, 25925, 27239, 30267, 31599, 32701, 33573, 31864, 32098, 32618, 33585, 33429, 34307, 33240, 33537, 35023, 35722, 35517, 32165, 31789, 32323, 32867, 30263, 29794, 29895, 28285, 32200, 32719, 34241, 34758, 32099, 30639, 29599, 30260, 28270, 28937, 27952, 26616, 34907, 36356, 36877, 37629, 36898, 38430, 38860, 40258, 41259, 40872, 42567, 36305, 36652, 36626, 37653, 35718, 35971, 35112, 36137, 35556, 35510, 36781, 37294, 34401, 33048, 32242, 32874, 31042, 37280, 38485, 39632, 40251, 38840, 38032, 38432, 39505, 37583, 39926, 41001, 41018, 42034, 40972, 42104, 41029, 39988, 39936, 39930, 40024, 38736, 37503, 38901, 39835, 39749, 38424, 38245, 37380, 36076, 35220, 34070, 35411, 35731, 36019, 35822, 35154, 34752, 35541, 36034, 35265, 36014, 36182, 37100, 33441, 33014, 32389, 31822, 32436, 31831, 30511, 30012, 32716, 34003, 34595, 36030, 36831, 36395, 38128, 30043, 28914, 27627, 27530, 29126, 29195, 30607, 30868, 31584, 26575, 25236, 24952, 25830, 24220, 23713, 23482, 22508, 22635, 23128, 24241, 25186, 26614, 27473, 21916, 21208, 22260, 21940, 23492, 24642, 25016, 25127, 25873, 25801, 24946, 26593, 25226, 25510, 24364, 24423, 26877, 27932, 27182, 29237, 23307, 22202, 22402, 22939, 20863, 20577, 20113, 20871, 21764, 21901, 20628, 20473, 22169, 20943, 23310, 19757, 18507, 18557, 17992, 17377, 16645, 15696, 16488, 16882, 16466, 17610, 19324, 19434, 20869, 21096, 18760, 18764, 19855, 17506, 21851, 23229, 23688, 23657, 24136, 24285, 24735, 23855, 23985, 24296, 23174, 23276, 21910, 20690, 20767, 20169, 19401, 19738, 18454, 17702, 18160, 21333, 21371, 22756, 22961, 20652, 19924, 19240, 20052, 20189, 19538, 21003, 23623, 24964, 25371, 25202, 25939, 25939, 26358, 27437, 28530, 26836, 26060, 27117, 27972, 28757, 29606, 27089, 27490, 28441, 29116, 30601, 31154, 28996, 14624, 16033, 17001, 18103, 16374, 16610, 17467, 16849, 17610, 17769, 15564, 14915, 14005, 13456, 14224, 15220, 14626, 14381, 14398, 13908, 13089, 13872, 15092, 12480, 12494, 11471, 11027, 10262, 13199, 13896, 14229, 15165, 13039, 12875, 13595, 11385, 13262, 13367, 12608, 11942, 12870, 12756, 11524, 12404, 12887, 12209, 12240, 12740, 12747, 13376, 11604, 11509, 12896, 13326, 10598, 10568, 10983, 11472, 10897, 13732, 15169, 15841, 16761, 15729, 17159, 17177, 17320, 17026, 15474, 15932, 15238, 15634, 15699, 16267, 17387, 15492, 14163, 13528, 14210, 13838, 12024, 11226, 11514, 9766, 15063, 15855, 17139, 17264, 16187, 16589, 16177, 17407, 18001, 61119, 59697, 59085, 60064, 61474, 62495, 58999, 58043, 58920, 57930, 59484, 61949, 63354, 59726, 72762, 73395, 73483, 74230, 73845, 74885, 73034, 72223, 72568, 74107, 73990, 73477, 75781, 74137, 76036, 75314, 76025, 77542, 78092, 79593, 73977, 75743, 78189, 77400, 75043, 74585, 75738, 76762, 77082, 77895, 72716, 72016, 73957, 75193, 77945, 75839, 76994, 72170, 87926, 89100, 88802, 88506, 87218, 86934, 90759, 91102, 89458, 89949, 88441, 87503, 87302, 91586, 66697, 66765, 67842, 69126, 68856, 70106, 64642, 63251, 65435, 68061, 70122, 67987, 70863, 65008, 71539, 72489, 71679, 70734, 69843, 68734, 73230, 72530, 71484, 70686, 71094, 72274, 73370, 72731, 71373, 70479, 72948, 73148, 72496, 74369, 73666, 70542, 71124, 73119, 73965, 74198, 74844, 75906, 75429, 76457, 75106, 75460, 76162, 75180, 77626, 74820, 75620, 75585, 74111, 73566, 72233, 75102, 76194, 73998, 73535, 71173, 65464, 66345, 64019, 65856, 65639, 66302, 67659, 65795, 66267, 65378, 75722, 76595, 74974, 74748, 76604, 59093, 60607, 58571, 58455, 59034, 70199, 70996, 69072, 69810, 71129, 75513, 76621, 75167, 75785, 74330, 69499, 70045, 69835, 70098, 68018, 20568, 21461, 20827, 19135, 20723, 77713, 78232, 67518, 63485, 72729, 22727, 61204, 74793, 63811, 84433, 71115, 75254, 68996, 56665, 62552, 66234, 56768, 85630, 30765, 43611, 64871, 19364, 42441, 55653, 37513, 81397, 84472, 18450, 53348, 64115, 62853, 70205, 65854, 45379, 50722, 73017, 20848, 73804, 37324, 60077, 79039, 62362, 55290, 72612, 67582, 60018, 70554, 60848 } }, temperature-factors isotropic { scale-factor 1000, b { 61639, 54770, 48459, 51270, 59110, 78169, 85099, 86180, 78699, 37659, 40869, 46470, 51659, 41970, 46580, 38500, 32290, 49610, 38930, 42060, 42369, 35659, 36979, 42389, 47709, 48229, 55360, 49630, 41569, 36400, 43349, 44299, 46430, 45279, 39150, 39240, 33680, 36000, 35700, 37650, 45000, 51520, 36310, 39340, 34669, 40220, 45599, 44049, 42159, 48500, 44209, 43479, 51770, 46840, 42759, 44049, 51479, 63049, 40819, 41169, 36349, 43779, 54869, 54169, 57229, 56319, 48540, 46549, 52630, 59270, 56220, 55139, 52290, 57229, 50729, 53069, 51950, 44650, 50720, 72589, 54380, 50959, 55439, 59229, 59650, 66470, 68250, 58310, 70559, 59639, 64059, 65989, 65010, 64559, 69180, 72709, 70360, 71510, 71639, 71309, 63250, 63509, 63509, 61619, 62090, 68370, 84620, 92279, 94819, 98029, 57020, 51709, 50150, 48040, 43750, 59650, 72959, 80580, 74169, 46220, 45520, 51520, 52529, 37729, 41400, 42430, 35930, 51009, 50729, 44779, 39389, 56099, 62400, 63849, 68400, 73830, 41150, 43009, 44029, 45529, 43970, 53599, 60340, 50000, 48860, 47959, 43720, 46360, 50250, 49869, 51540, 50830, 46430, 22569, 45880, 49349, 49599, 43549, 40009, 57909, 70160, 69349, 71379, 72839, 41060, 47169, 49759, 48099, 59110, 68379, 58509, 77900, 47439, 42990, 40430, 36069, 44819, 39509, 36240, 43509, 44549, 45950, 41380, 51209, 33830, 33029, 35290, 41520, 44400, 30600, 27209, 25370, 40130, 32049, 32919, 40909, 25850, 29799, 18729, 27409, 36599, 29239, 37790, 39680, 29920, 38060, 37389, 41560, 49159, 37279, 31170, 33720, 33290, 29239, 28930, 29229, 35580, 31530, 31780, 36069, 30979, 28909, 28770, 31530, 44740, 26629, 29829, 33840, 43290, 27090, 31899, 35029, 25049, 35950, 34919, 37680, 38700, 32849, 25079, 33659, 40880, 31329, 37270, 40020, 39470, 46520, 43560, 37950, 41659, 23860, 28219, 49889, 49770, 51000, 41360, 47479, 45330, 35770, 49180, 50740, 49919, 48349, 54139, 34830, 33919, 37490, 33009, 47610, 51700, 59849, 60110, 57979, 46700, 48979, 66470, 67790, 68800, 70730, 73650, 64160, 75760, 74750, 76089, 81410, 78199, 81220, 78870, 81389, 89379, 91629, 88269, 90099, 92360, 92349, 95489, 94309, 95699, 96870, 98059, 97440, 103480, 97989, 99190, 99400, 99150, 102129, 101220, 101419, 101410, 100959, 101160, 99099, 99050, 103669, 107809, 109559, 109279, 109669, 109830, 110160, 109839, 98620, 100300, 98989, 103330, 104419, 101059, 100660, 91750, 85059, 80779, 81029, 95330, 104629, 73029, 67250, 64879, 62900, 65370, 63919, 63869, 63299, 66089, 67620, 66940, 65230, 57880, 56450, 55590, 58430, 46509, 54659, 58540, 68559, 64819, 61630, 66029, 51130, 45939, 41650, 40990, 35889, 30290, 45720, 35950, 47759, 39919, 46439, 43200, 43340, 41299, 44569, 44919, 45479, 47740, 39330, 38099, 39759, 35450, 48069, 67949, 61330, 72190, 79290, 36450, 40400, 42209, 36479, 28590, 31040, 36860, 34490, 38950, 37959, 39479, 34490, 48689, 35900, 31989, 37319, 38720, 37029, 37959, 37240, 29959, 32520, 37490, 32479, 34139, 29079, 34509, 30780, 32310, 19690, 33930, 33830, 39020, 38880, 35389, 41279, 22010, 36930, 38380, 39189, 38950, 29760, 30479, 40819, 57560, 35740, 30600, 35959, 33869, 30399, 30709, 21180, 20219, 23969, 21040, 24690, 26719, 37549, 23239, 30079, 37430, 39549, 14779, 26979, 26659, 14449, 41830, 36979, 39750, 44380, 33290, 30350, 47950, 33470, 36680, 41529, 46029, 44779, 37000, 36130, 33259, 24110, 47069, 48750, 49709, 52159, 46669, 54659, 55189, 53860, 50360, 41840, 46500, 44259, 40799, 42250, 44110, 23790, 46529, 37639, 49229, 41360, 47000, 42580, 40840, 39139, 43560, 47659, 40119, 35049, 28860, 41919, 42049, 43080, 50590, 52400, 45709, 45389, 48040, 52340, 46900, 49110, 54200, 57729, 41409, 53409, 48270, 50509, 53970, 56959, 57119, 59819, 65330, 75139, 78099, 63930, 88769, 50639, 47189, 48349, 52750, 49240, 50900, 41029, 41939, 45389, 41049, 25250, 34490, 30809, 34340, 45209, 48139, 44509, 45419, 47599, 50990, 45889, 44840, 39430, 45819, 44689, 47229, 42490, 45799, 49500, 54509, 45250, 54250, 47259, 50759, 44599, 39669, 40090, 35740, 26079, 45319, 47409, 48770, 56159, 47240, 49540, 39189, 35299, 33720, 39319, 38029, 38360, 39939, 36549, 32599, 30110, 36529, 36889, 47029, 64419, 63169, 27620, 34069, 32139, 35020, 28370, 29329, 31860, 32069, 29469, 34799, 35479, 35319, 46090, 46299, 39450, 29799, 34909, 37569, 35990, 26030, 24510, 19870, 35909, 31479, 33840, 38840, 29600, 28520, 19540, 28850, 30319, 30819, 31750, 31399, 26620, 52419, 49099, 39229, 48790, 30340, 40380, 32869, 16229, 31579, 34029, 31209, 30799, 28750, 23610, 39069, 36639, 29590, 28520, 27670, 36490, 37959, 31829, 46139, 35310, 31840, 32779, 34520, 37619, 41169, 34680, 44770, 50409, 67260, 31770, 31020, 29860, 29340, 31200, 36970, 27979, 28770, 27780, 28680, 30059, 27360, 32779, 30479, 32860, 30930, 43270, 26299, 37729, 31680, 40759, 44000, 50470, 31549, 40909, 36540, 36330, 38240, 47840, 60750, 45549, 65980, 32779, 35450, 32080, 37439, 35540, 41349, 38220, 47419, 40830, 45909, 46060, 46049, 30209, 34099, 32669, 35099, 25479, 28559, 29260, 35599, 38970, 13640, 25770, 27209, 23520, 37860, 33319, 31790, 33569, 22379, 19239, 13270, 31079, 30450, 40639, 38689, 30170, 24920, 37240, 23959, 41450, 37669, 40720, 46150, 32169, 39770, 32020, 29280, 33299, 43090, 50240, 39159, 42450, 42060, 44709, 38080, 58860, 63549, 64099, 63639, 46520, 42259, 43369, 45580, 38369, 59290, 57669, 38360, 47090, 47319, 51830, 57909, 55279, 57810, 44709, 49849, 45639, 42580, 46360, 59009, 75440, 77489, 79629, 37279, 39959, 43750, 44040, 34049, 35810, 35479, 25459, 46500, 42759, 45290, 46229, 41409, 49779, 58090, 73430, 79129, 45150, 42150, 41250, 47029, 45389, 56950, 59880, 56009, 40409, 37830, 35110, 43049, 38990, 34840, 38950, 39290, 34220, 33740, 35900, 38209, 33349, 31649, 31940, 31950, 29870, 32130, 21379, 37680, 31870, 33330, 33459, 43000, 41029, 46659, 51200, 45150, 49439, 47080, 49430, 55819, 38119, 30780, 33819, 39840, 48630, 54009, 47220, 43080, 35279, 36569, 37310, 34240, 34770, 30319, 23200, 37099, 33310, 29860, 32580, 39889, 38169, 48369, 50709, 52380, 72730, 81870, 78269, 33470, 30969, 31000, 37790, 12279, 24930, 38139, 35959, 31899, 23389, 27399, 32860, 16540, 18299, 20379, 25479, 30430, 28270, 27950, 32990, 35779, 40259, 28129, 30280, 31250, 31500, 32669, 25129, 30680, 17120, 33400, 46409, 40299, 39819, 32599, 28870, 32319, 38029, 34110, 36770, 32119, 34110, 15319, 26549, 32900, 33979, 32150, 38069, 26540, 34049, 27110, 30540, 27479, 29739, 36520, 26350, 25829, 32919, 50340, 47610, 44919, 46000, 33990, 36259, 39259, 50720, 33270, 31920, 15850, 42340, 35860, 38759, 44169, 49970, 25579, 27969, 36849, 45569, 35529, 40549, 41159, 42389, 46680, 23620, 18389, 24739, 41860, 60909, 40990, 37330, 42520, 48240, 46119, 48919, 38590, 37349, 40939, 43349, 46549, 51240, 47630, 47430, 45740, 37290, 42889, 55389, 59400, 64400, 66730, 36459, 40580, 43669, 45319, 34310, 36580, 35770, 29680, 43529, 38930, 41909, 43659, 37590, 58319, 38049, 38680, 38830, 43220, 34610, 36520, 33580, 36310, 41209, 39479, 46069, 49200, 39580, 44819, 44849, 47659, 46479, 44439, 32189, 47759, 40119, 33880, 37430, 35330, 19260, 34349, 39029, 37779, 39290, 41409, 42389, 47700, 40930, 37799, 41060, 41169, 41220, 39500, 28360, 33069, 44540, 37439, 40830, 42779, 34729, 45529, 27709, 52319, 35419, 33020, 36090, 40869, 24889, 34360, 18670, 28600, 42869, 29059, 35509, 32529, 31510, 37860, 31239, 34040, 32389, 30909, 36869, 28959, 27180, 36729, 38040, 34500, 32529, 39279, 32540, 32119, 42090, 41349, 46479, 38459, 41729, 26639, 31950, 42650, 45139, 41450, 39279, 37750, 46810, 36790, 30149, 19920, 33729, 38200, 43459, 49319, 43169, 43290, 47119, 60580, 45029, 38619, 33330, 33709, 33819, 27879, 29899, 36979, 32950, 40630, 35200, 30840, 39650, 43119, 41150, 43810, 45189, 39250, 41110, 37209, 35310, 38700, 39659, 36590, 50810, 47849, 29110, 32979, 35889, 38569, 24450, 26629, 30219, 18899, 32860, 30250, 31329, 37759, 27100, 37889, 39220, 44279, 37650, 41970, 39419, 45479, 35400, 34040, 35729, 42610, 28659, 42810, 21989, 52229, 35290, 32389, 41959, 44029, 36049, 25879, 34959, 42659, 30940, 38979, 35869, 38919, 44319, 45840, 49650, 43119, 42000, 40470, 41979, 45229, 49139, 52849, 55209, 41490, 44959, 48659, 38349, 53830, 52389, 48299, 44650, 36840, 51409, 50409, 52580, 45119, 40189, 47169, 48049, 37080, 33650, 38169, 53720, 56939, 61400, 66220, 65440, 64319, 62750, 62139, 61380, 62919, 67000, 69400, 72860, 62319, 73150, 85900, 95250, 87470, 66760, 64650, 65559, 65889, 57290, 59220, 67879, 62150, 59180, 61110, 54880, 55779, 59360, 67480, 49099, 58500, 57729, 49689, 54389, 52790, 51930, 55590, 58549, 69449, 65260, 65430, 48619, 56729, 63580, 62400, 41990, 55830, 68050, 70599, 69639, 69580, 69980, 70580, 66660, 71230, 78069, 81750, 80260, 84540, 89379, 93690, 95919, 85069, 84510, 82269, 97230, 99050, 100569, 101639, 100400, 99750, 99720, 99589, 100529, 101000, 101099, 104589, 103419, 98389, 97430, 95000, 95889, 105930, 113870, 119339, 126269, 117790, 93300, 92279, 91470, 92750, 97370, 98080, 88650, 84739, 79599, 79699, 84790, 84620, 86669, 74449, 67040, 61759, 58599, 69930, 71430, 85250, 69309, 54810, 49759, 51520, 53889, 48310, 54020, 46310, 47189, 49049, 45900, 49950, 62299, 81669, 73220, 80930, 47430, 43919, 45009, 45689, 44479, 48650, 49040, 49209, 37669, 44939, 43130, 40919, 35909, 47810, 39130, 40400, 39180, 42970, 40169, 35720, 55990, 41419, 42830, 42209, 41049, 40939, 35509, 39500, 36200, 15260, 35700, 42290, 45220, 46549, 45950, 45689, 51189, 41750, 48889, 45119, 43669, 44689, 45720, 36840, 42750, 36669, 40740, 41639, 45880, 47099, 49919, 55919, 67080, 74559, 77750, 70709, 49099, 51810, 51409, 52590, 49939, 48900, 46459, 43619, 41169, 44439, 43580, 40159, 53700, 52360, 43810, 39380, 55430, 61750, 61610, 57970, 43200, 44759, 46939, 49759, 41659, 45180, 46479, 44860, 51360, 46919, 50330, 50639, 47790, 49130, 45979, 44970, 44319, 48139, 51470, 48349, 48229, 38959, 54650, 46209, 45599, 46229, 44779, 35619, 51919, 48159, 42479, 39299, 39150, 36380, 25559, 28370, 23709, 37209, 32400, 24309, 28510, 22229, 29510, 41330, 49279, 48759, 51529, 43659, 47849, 58509, 51959, 58950, 60250, 66050, 66550, 75699, 74230, 57560, 53389, 50779, 57970, 48459, 56250, 51380, 48099, 47060, 48250, 48099, 46990, 49720, 60919, 70830, 76180, 76589, 80819, 79330, 44799, 45200, 44500, 47090, 43880, 56080, 39299, 43430, 46069, 47009, 23989, 28569, 29350, 38549, 28139, 46979, 45259, 48130, 48840, 48680, 47950, 48060, 46779, 44000, 52590, 53220, 50549, 48819, 54270, 56159, 57560, 46569, 53970, 58630, 65160, 65870, 60369, 60090, 69410, 69110, 69470, 65930, 68029, 71019, 71110, 68779, 69290, 67190, 63979, 78290, 91779, 68199, 68389, 67519, 68300, 73839, 89330, 73709, 63889, 57290, 57700, 57560, 58669, 53459, 56909, 57279, 59619, 57909, 62779, 67720, 70129, 71760, 72760, 84690, 90150, 91830, 97620, 66290, 59950, 58830, 55130, 66580, 71589, 73910, 85739, 90669, 88489, 72949, 50189, 46240, 48970, 44799, 45150, 50299, 57500, 61250, 61520, 57959, 54490, 58509, 57419, 54590, 58750, 65730, 70150, 77910, 55950, 60069, 63909, 63509, 68059, 73959, 83080, 81190, 82099, 67400, 69209, 69010, 68239, 68489, 69089, 69040, 68970, 69910, 68480, 64010, 64199, 60119, 69290, 73199, 65339, 64750, 64639, 62919, 63619, 66110, 77150, 80239, 81650, 77940, 56159, 55110, 57770, 63790, 52700, 55849, 54500, 48189, 42340, 54319, 40900, 51419, 39119, 41549, 46590, 51639, 45200, 38709, 51319, 39590, 47619, 43479, 47740, 46439, 53270, 53159, 39470, 43369, 46970, 50340, 50520, 45709, 46560, 48580, 43740, 55259, 64040, 57659, 42049, 45810, 49200, 50340, 51549, 52889, 49880, 41490, 38439, 36590, 48659, 47450, 45790, 50709, 42409, 40569, 47150, 45040, 50360, 48270, 49169, 48240, 35770, 61340, 52040, 55979, 57409, 58330, 52509, 58220, 59369, 58099, 56340, 54419, 55069, 64489, 52790, 56599, 56580, 50779, 63409, 55930, 55500, 53639, 57479, 59650, 54560, 55860, 53869, 59409, 61400, 60029, 66400, 64800, 63360, 61560, 58380, 67319, 75480, 83639, 90050, 59779, 56470, 53779, 53580, 40189, 56360, 56169, 60509, 50869, 45759, 48340, 47490, 53459, 45139, 41380, 49650, 51830, 50599, 49130, 52619, 43560, 48090, 47060, 55569, 51540, 56979, 43400, 35220, 32060, 42270, 32259, 36189, 45509, 24239, 27989, 29209, 37880, 28420, 30270, 35549, 47060, 49569, 47450, 47060, 51470, 51860, 50659, 58340, 54529, 45560, 54450, 65529, 67599, 70260, 54110, 45650, 46930, 50779, 47430, 49509, 58830, 63279, 61080, 58009, 48560, 49200, 48169, 48189, 55750, 44069, 51770, 48939, 54819, 48409, 56090, 54229, 61700, 48790, 43020, 47130, 53970, 42319, 46950, 43569, 52819, 47259, 53939, 52310, 50709, 56840, 56830, 57549, 56900, 59509, 65449, 69120, 69379, 70769, 70940, 72959, 70839, 53819, 51819, 53560, 49630, 55810, 50680, 49020, 51610, 51099, 47090, 51110, 51369, 53709, 56520, 38389, 50159, 42209, 40319, 38419, 41619, 31540, 43610, 39830, 46569, 52590, 55299, 50990, 50409, 44950, 54279, 54389, 56369, 55790, 53729, 55000, 54250, 54759, 49930, 49790, 51409, 35430, 45069, 48630, 50930, 47569, 43099, 43040, 49549, 51689, 57110, 59599, 50799, 50060, 48750, 59849, 52270, 44209, 43400, 53619, 56729, 55849, 46540, 45939, 46869, 54500, 58650, 58509, 72250, 62990, 42909, 40200, 42590, 42509, 42619, 50880, 34840, 42619, 41869, 45540, 46659, 44860, 42049, 39409, 44150, 43270, 46220, 50490, 55470, 40619, 38779, 31719, 32369, 39770, 43369, 38599, 53979, 48069, 47650, 51029, 27950, 30409, 35770, 36770, 34830, 26840, 25309, 27379, 37240, 38450, 21170, 32299, 35430, 34360, 28530, 37979, 38630, 39270, 42790, 36360, 36939, 34569, 37759, 43000, 39529, 40849, 42979, 42700, 26760, 43189, 43369, 39549, 38889, 36500, 32180, 39009, 43979, 42500, 44159, 46470, 46009, 47439, 47299, 48970, 39279, 50860, 46729, 50150, 41689, 42080, 43479, 43380, 42509, 48909, 43680, 41209, 36509, 39369, 38799, 36869, 32709, 28200, 45209, 40189, 36990, 39700, 42630, 58810, 53060, 69510, 30719, 36169, 40630, 44790, 21290, 24959, 21229, 39750, 39349, 25409, 44040, 41869, 46900, 41220, 39060, 53110, 71489, 58529, 70300, 36130, 34880, 39279, 30270, 29819, 41500, 30659, 37779, 29299, 36090, 36209, 35130, 38799, 44729, 43200, 35650, 39029, 41529, 40389, 42880, 47419, 36069, 38750, 42939, 53720, 51189, 48090, 49540, 61380, 48380, 57770, 53279, 52619, 53959, 50409, 40590, 51950, 38970, 49959, 63680, 66230, 70290, 56799, 59110, 43310, 55880, 64610, 69230, 70769, 72500, 62450, 56180, 74610, 76339, 78209, 79599, 80819, 79050, 83839, 85430, 88010, 86989, 89379, 97769, 101449, 94580, 84660, 84029, 80839, 81309, 87239, 93650, 78559, 72129, 66900, 63240, 67300, 74739, 65300, 58549, 56880, 52479, 64849, 76419, 79809, 80459, 53430, 52840, 49520, 42330, 46599, 66800, 38930, 36700, 35840, 39599, 43709, 37740, 34360, 41549, 39599, 35639, 40299, 39509, 37200, 35750, 33700, 35819, 39229, 28200, 37069, 34720, 25649, 37720, 24629, 23579, 37099, 36090, 33549, 32409, 39009, 31100, 36880, 35880, 39790, 42439, 39990, 31170, 23559, 32659, 25930, 44259, 44279, 45540, 42939, 45479, 54330, 51860, 46610, 55169, 46970, 49819, 48029, 44659, 45540, 63630, 80819, 90919, 86489, 41630, 37200, 39150, 46560, 41490, 43560, 40319, 37040, 37580, 45299, 36919, 48409, 44099, 38830, 40270, 42159, 40860, 40209, 39790, 33700, 36680, 39349, 41000, 29110, 36509, 40000, 22469, 42549, 37689, 35409, 35950, 34009, 56400, 66459, 67239, 78290, 41700, 43959, 39740, 45060, 42400, 53840, 61369, 67319, 45099, 38689, 46110, 52700, 49430, 45560, 52860, 54630, 55819, 52549, 48759, 55610, 55580, 57200, 49349, 52029, 55400, 55400, 47619, 68160, 55319, 48580, 55979, 56000, 55419, 52939, 48000, 38840, 61200, 53659, 60470, 60979, 64709, 63180, 58880, 49549, 45000, 44299, 48490, 30250, 38709, 24600, 33380, 48680, 39299, 42270, 43419, 41099, 29190, 29850, 29389, 37610, 31409, 31969, 39490, 42069, 41639, 39009, 37330, 50209, 44299, 42459, 40099, 26909, 33119, 29510, 26530, 32669, 34569, 44290, 33189, 31950, 34450, 35250, 30250, 32779, 27969, 26610, 21250, 28180, 27549, 32490, 28979, 28959, 31159, 35790, 36610, 32509, 34529, 35549, 38369, 30309, 40500, 31649, 30469, 29540, 38810, 45540, 47099, 36720, 41939, 37790, 39930, 32599, 36159, 38849, 43409, 44680, 47200, 46060, 49450, 43439, 45490, 46819, 50639, 50009, 46639, 39189, 44250, 44389, 32799, 51860, 51400, 51680, 51919, 49000, 53729, 51049, 50659, 57900, 59590, 60869, 57590, 51119, 65870, 71190, 69169, 64699, 63819, 71300, 72660, 74199, 75040, 71879, 68230, 65779, 62720, 72569, 74040, 72150, 63849, 54470, 54560, 54830, 47650, 46119, 49830, 43669, 38860, 42849, 44080, 51380, 48139, 38299, 42619, 48720, 46090, 34279, 41450, 48310, 48569, 63700, 48150, 44520, 44590, 43700, 51520, 43069, 49500, 47979, 55189, 57639, 60229, 68300, 70309, 58150, 62849, 64120, 65080, 67849, 67459, 67940, 67669, 67650, 67370, 74629, 76099, 74779, 71709, 84540, 87559, 89129, 93190, 77309, 75900, 75970, 76540, 79949, 87279, 83389, 83660, 83730, 78220, 75989, 73849, 76080, 79779, 94519, 92779, 97099, 84870, 71150, 69449, 67970, 64459, 79639, 78879, 85839, 97069, 97800, 65839, 64559, 61819, 62049, 59909, 61970, 63639, 55659, 54669, 51209, 47229, 56819, 57500, 59500, 57310, 57220, 47669, 51889, 51150, 49270, 54810, 66290, 55180, 50180, 48669, 45369, 37139, 49270, 41340, 50720, 52220, 50099, 56349, 59389, 61000, 59450, 65639, 72599, 66860, 61169, 55729, 57869, 66470, 48220, 57889, 64349, 64389, 62650, 63919, 69569, 65599, 65269, 61819, 63439, 65620, 66410, 65540, 74050, 64860, 63279, 58720, 58909, 59860, 52200, 48040, 55860, 57169, 62049, 60299, 54229, 67910, 70720, 72629, 68919, 74480, 89819, 92690, 98569, 92510, 75180, 71849, 67680, 69730, 82000, 91160, 106720, 97559, 62950, 62310, 60299, 58720, 54930, 53479, 51310, 58430, 59619, 63500, 60970, 57290, 62520, 56830, 68769, 70370, 63770, 57619, 60630, 61779, 60159, 60029, 54200, 53479, 56430, 53330, 66220, 49830, 52290, 48909, 46900, 52840, 59819, 60000, 46869, 45099, 42880, 42990, 43599, 34029, 47470, 41939, 41189, 42880, 48779, 51389, 39150, 38029, 39680, 37310, 36520, 45740, 39919, 50220, 51490, 45700, 49549, 58639, 59150, 63490, 68120, 71970, 39680, 39439, 39490, 31920, 41470, 45720, 50369, 50169, 42500, 42259, 34770, 30620, 47130, 42529, 39099, 40709, 42840, 38650, 38119, 38740, 36099, 43099, 41119, 40080, 42290, 40889, 46639, 48759, 41130, 36900, 34029, 35889, 34770, 33639, 34659, 48209, 35250, 40340, 47630, 44400, 50500, 59290, 64540, 45830, 54130, 59069, 59450, 56220, 61979, 60430, 54040, 68569, 59689, 73930, 81519, 84110, 74440, 82970, 86489, 89830, 93669, 87239, 75309, 87510, 92400, 96610, 96959, 94029, 99739, 103110, 105510, 106639, 105410, 106919, 105839, 103970, 109139, 112300, 117940, 113720, 105470, 107099, 106330, 108819, 109150, 107519, 107489, 107459, 101360, 97430, 95319, 97860, 93629, 85500, 99379, 92529, 89889, 88449, 85370, 86089, 84559, 84239, 82050, 76620, 71760, 85510, 86019, 76230, 74589, 77750, 75730, 78620, 85330, 92760, 96410, 98550, 75650, 72360, 69739, 69120, 64330, 50119, 57000, 51619, 63099, 65419, 63310, 60060, 55590, 68779, 81309, 85599, 88790, 62250, 63819, 63709, 65650, 61659, 58729, 69110, 51099, 63229, 61389, 57700, 59919, 61380, 65569, 75250, 77150, 75550, 72860, 72739, 50560, 42860, 45880, 43330, 31719, 33419, 44790, 59569, 45299, 49189, 52770, 53430, 56169, 58040, 61340, 63520, 49000, 50790, 52919, 56110, 57889, 48689, 46799, 42869, 48189, 36869, 40009, 36459, 50610, 51200, 47430, 40380, 52119, 65550, 71489, 66089, 76069, 43540, 43709, 41409, 39189, 45009, 30840, 42549, 36310, 43970, 44560, 43319, 40860, 36720, 35349, 43830, 44849, 43840, 44259, 42400, 45299, 38130, 41159, 37810, 38069, 34650, 38470, 38029, 38549, 36110, 31440, 33040, 32860, 34279, 32830, 32509, 37259, 35849, 40979, 38900, 35639, 34580, 49150, 33119, 29200, 36000, 41270, 42139, 40400, 37400, 45189, 43400, 43560, 47979, 37159, 40020, 39490, 37319, 38099, 28540, 39419, 33159, 34340, 41240, 42060, 38930, 47919, 50389, 51360, 50970, 55779, 51619, 54520, 46189, 49340, 50319, 41310, 40939, 42779, 43590, 48319, 46009, 49220, 46959, 52189, 49080, 37490, 53729, 41720, 52250, 53659, 48770, 51439, 49830, 51509, 44830, 38619, 28569, 41439, 47529, 44409, 44700, 45279, 40279, 40799, 42209, 46360, 48400, 43779, 51520, 51770, 51169, 43680, 44180, 44900, 44750, 48799, 41689, 34000, 48720, 52700, 52759, 48990, 55319, 64860, 53860, 60150, 62520, 59330, 55909, 45959, 53970, 38770, 56259, 53880, 47970, 41930, 57500, 69120, 45479, 46290, 54840, 52229, 43529, 56450, 58950, 53919, 59500, 56490, 56389, 50169, 46250, 42259, 38369, 44819, 36779, 45040, 35549, 47060, 50189, 49720, 42419, 56740, 59639, 60169, 60450, 60380, 54430, 59919, 62349, 63080, 63159, 64529, 66400, 52880, 58340, 54729, 52369, 52110, 56409, 54119, 37880, 40970, 55159, 55450, 50159, 44250, 58680, 69099, 81169, 84459, 85639, 81839, 94150, 50990, 49400, 46330, 45169, 64720, 70760, 63319, 68599, 45119, 49099, 49869, 44720, 46360, 38590, 34360, 37180, 49970, 48479, 50939, 54229, 48439, 50279, 39889, 42889, 48669, 49939, 52700, 49939, 52509, 52330, 55860, 54610, 45220, 52909, 42110, 40259, 51319, 53560, 48150, 50840, 49439, 35270, 49689, 56450, 61659, 57689, 52250, 40150, 40450, 43450, 28500, 31100, 33189, 40340, 36299, 42540, 43240, 40509, 29659, 43790, 41209, 33990, 33200, 45220, 49979, 47409, 54430, 60500, 68760, 72069, 81879, 73129, 43689, 40340, 40650, 39750, 40750, 49180, 48459, 48990, 44409, 61509, 57849, 61959, 46290, 45090, 41880, 32990, 40700, 42240, 44380, 44669, 35509, 38139, 41270, 50180, 45419, 50130, 48110, 49250, 45569, 51110, 42560, 40759, 38540, 40290, 44799, 40529, 40799, 35590, 47090, 44500, 34540, 33479, 38580, 39740, 38490, 38950, 44540, 47139, 46939, 46029, 47450, 45840, 44700, 37069, 39520, 31079, 34709, 41119, 37959, 33189, 34619, 38119, 39150, 37900, 42490, 26479, 26569, 29979, 43380, 44770, 43169, 43509, 44799, 47139, 52810, 49270, 39900, 46319, 40439, 37060, 42959, 36919, 21649, 27870, 46740, 52930, 48639, 51630, 52290, 46419, 55209, 61169, 55790, 48950, 51720, 52979, 53330, 35939, 49090, 49319, 43310, 55729, 52119, 52349, 49909, 48470, 41810, 40349, 39029, 58759, 60029, 54490, 51959, 59549, 73069, 78389, 71790, 69879, 50439, 53830, 52080, 51900, 54970, 58990, 65819, 68099, 55349, 49580, 49569, 51229, 49060, 47939, 46610, 39090, 40720, 54580, 59759, 64089, 61979, 59560, 58169, 53500, 53180, 57659, 56610, 43250, 51439, 53689, 50750, 68849, 67830, 66629, 67180, 72190, 73080, 71669, 75080, 69290, 77110, 81599, 84569, 79099, 82589, 83370, 84819, 80330, 84559, 80949, 85910, 86360, 85050, 84449, 87480, 87800, 92180, 88040, 92540, 94819, 95260, 84459, 82870, 85769, 89379, 76319, 83739, 79599, 76720, 77470, 77839, 81910, 86970, 86940, 92139, 97059, 96330, 75750, 73790, 65970, 63819, 74459, 82510, 90330, 84459, 61409, 60900, 61189, 60639, 62979, 59770, 54060, 55740, 63740, 60439, 56619, 54990, 67080, 74290, 48560, 53970, 53290, 55380, 57590, 49810, 40830, 30860, 38509, 54259, 54459, 55520, 55040, 55779, 67120, 50119, 50009, 48709, 48810, 34959, 47919, 51750, 52770, 53229, 56310, 52490, 50040, 49770, 50939, 54389, 53959, 56009, 66360, 48340, 46770, 40400, 34840, 42790, 40909, 56200, 35939, 38490, 39500, 44180, 42189, 32020, 39479, 39290, 36810, 34560, 38799, 44200, 58099, 45840, 45869, 44639, 47599, 47189, 43439, 38430, 51209, 46439, 46630, 44680, 43060, 39209, 41770, 36080, 30879, 40409, 40029, 41650, 38349, 45540, 54180, 49229, 47650, 46000, 51099, 44009, 45349, 46860, 47830, 38849, 43599, 47900, 44830, 37459, 47860, 47849, 51159, 48540, 44860, 43009, 44110, 52900, 58819, 57430, 55220, 52930, 70550, 73790, 77059, 64989, 55950, 57069, 56290, 59979, 49159, 68269, 60659, 60349, 58759, 60389, 62590, 64449, 68230, 81029, 65309, 65489, 65989, 64510, 66660, 62490, 60919, 67669, 66849, 64239, 63659, 61159, 67050, 58750, 63389, 61630, 62029, 68669, 66589, 72330, 81620, 70970, 61259, 61090, 61900, 61279, 59319, 57659, 45930, 53479, 65339, 68099, 63720, 58259, 71019, 75980, 77599, 75949, 75720, 74809, 78510, 85400, 65529, 68150, 67750, 66739, 73319, 82989, 88389, 92480, 94930, 87400, 95169, 63869, 64400, 64650, 65879, 54250, 40180, 52209, 54889, 65779, 69160, 71290, 74290, 69580, 76910, 82019, 86819, 88260, 72930, 72879, 71459, 78489, 81360, 83339, 97319, 97339, 99949, 66339, 62490, 60740, 62369, 60380, 52319, 50790, 60669, 56360, 60549, 60610, 50919, 47029, 54380, 60650, 59470, 64779, 62700, 63790, 65089, 66139, 68050, 66870, 62220, 68739, 67370, 71080, 73010, 74599, 69230, 77260, 81650, 87389, 93849, 73330, 71389, 71199, 72699, 72989, 74120, 73500, 74730, 69440, 63340, 67639, 61000, 59209, 60569, 72940, 74690, 75129, 77690, 75569, 68730, 71199, 70980, 78660, 66860, 81540, 82949, 83730, 83870, 81690, 86199, 85879, 84199, 85629, 83989, 93599, 95139, 97040, 97220, 78849, 75059, 72300, 74900, 67970, 62810, 58069, 55590, 55240, 54069, 45080, 50119, 54130, 54090, 53060, 56080, 48919, 52360, 41020, 48470, 53169, 54610, 56439, 55830, 49169, 49400, 52340, 52490, 58520, 58619, 56819, 60869, 55900, 68889, 59060, 55759, 54659, 56819, 58150, 48330, 54810, 44919, 52490, 39080, 41069, 45180, 56659, 50270, 52970, 49709, 48540, 60509, 53450, 54880, 51979, 55880, 58110, 55069, 54619, 60959, 51299, 56750, 55080, 59470, 64949, 65709, 67440, 63630, 65410, 67860, 53709, 49500, 54610, 54099, 54169, 66449, 69330, 67349, 66260, 73379, 74269, 79540, 86309, 88599, 84510, 87360, 66519, 72010, 75250, 81300, 61840, 71910, 69639, 69269, 67319, 73300, 73309, 70440, 72569, 72540, 76629, 75379, 72180, 70129, 70050, 70129, 69959, 70569, 88430, 88849, 91419, 96110, 82089, 92120, 91279, 91389, 93790, 86839, 89690, 87190, 85309, 83410, 92739, 99930, 103589, 103269, 108000, 82849, 73489, 67699, 69989, 73129, 76330, 80620, 76660, 76199, 61470, 59029, 59729, 57220, 55200, 61939, 44779, 44630, 56209, 52580, 53490, 48330, 50270, 39779, 44849, 30430, 50860, 49779, 50569, 46549, 46060, 63029, 52159, 59119, 56500, 49830, 59709, 76750, 80529, 91669, 86000, 58369, 59360, 58840, 61930, 61319, 79209, 86089, 92000, 96510, 56500, 55610, 58909, 57000, 51220, 45270, 56450, 55110, 57389, 64029, 68120, 71569, 62689, 53709, 51880, 55200, 68239, 75040, 80300, 80970, 84459, 98830, 97250, 100470, 89510, 88129, 91940, 94769, 96010, 95129, 93660, 96970, 100599, 92720, 98510, 99199, 91919, 92129, 98620, 43580, 43619, 45400, 50360, 48500, 48340, 40840, 35470, 42159, 45990, 53970, 48580, 57110, 40099, 81449, 86349, 86790, 86669, 85849, 83370, 92940, 87830, 87059, 82430, 64680, 69569, 72709, 75709, 75449, 75639, 73860, 76000, 71250, 71029, 76790, 71440, 76250, 74800, 96510, 99919, 101029, 101150, 100160, 99750, 103629, 105019, 101790, 100889, 101349, 98589, 101540, 105480, 48450, 50419, 49619, 48470, 50810, 53919, 48880, 43700, 51500, 47759, 50060, 55450, 56250, 55619, 61169, 59229, 58389, 61240, 62200, 59150, 55139, 56299, 63740, 64680, 37000, 40299, 34500, 38520, 36939, 36139, 44209, 46020, 36819, 35840, 37439, 34979, 43490, 51500, 53369, 56720, 60700, 55459, 52099, 50319, 62110, 60700, 57159, 53330, 51020, 72610, 75279, 78650, 78699, 76889, 74730, 74980, 79160, 78930, 74970, 71379, 108870, 112650, 110209, 109930, 107580, 109809, 107980, 112589, 111349, 109860, 114669, 111379, 113599, 112769, 113180, 50729, 62590, 48590, 56740, 59340, 68980, 68519, 70940, 73470, 71330, 71480, 72970, 69110, 72449, 72739, 74040, 76000, 75150, 77269, 75699, 83889, 84790, 90379, 92230, 91610, 34840, 55270, 41630, 57369, 57340, 54259, 43709, 48790, 28639, 49090, 60389, 55229, 57509, 56360, 36470, 30340, 81690, 66339, 82279, 43409, 48709, 54000, 44450, 43400, 55099, 46490, 35950, 41049, 54590, 37959, 59310, 40389, 52340, 46049, 52619, 40610, 51560, 61979, 45450, 40400, 51340, 48330, 60669, 71690, 44880, 49909, 84419, 50770 } }, occupancies { scale-factor 1000, o { 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 500, 500, 500, 500, 500, 500, 500, 500, 500, 500, 500, 500, 500, 500, 500, 500, 500, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 1000, 1000, 1000, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 9, 9, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000, 1000 } } } }, { id 2, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 1, to 4 } }, surface brick { corner-000 { scale-factor 1000000, x 55266356, y 13138963, z 67506298 }, corner-001 { scale-factor 1000000, x 53561300, y 12112211, z 67702674 }, corner-010 { scale-factor 1000000, x 55258699, y 13153788, z 67517325 }, corner-011 { scale-factor 1000000, x 53553643, y 12127036, z 67713701 }, corner-100 { scale-factor 1000000, x 51806356, y 17343963, z 59450298 }, corner-101 { scale-factor 1000000, x 50101300, y 16317211, z 59646674 }, corner-110 { scale-factor 1000000, x 51798699, y 17358788, z 59461325 }, corner-111 { scale-factor 1000000, x 50093643, y 16332036, z 59657701 } } } }, { id 3, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 5, to 11 } }, surface brick { corner-000 { scale-factor 1000000, x 49162474, y 19602854, z 57848184 }, corner-001 { scale-factor 1000000, x 47362066, y 19144526, z 58588769 }, corner-010 { scale-factor 1000000, x 49153933, y 19615473, z 57835230 }, corner-011 { scale-factor 1000000, x 47353525, y 19157145, z 58575815 }, corner-100 { scale-factor 1000000, x 47523474, y 5343854, z 45039184 }, corner-101 { scale-factor 1000000, x 45723066, y 4885526, z 45779769 }, corner-110 { scale-factor 1000000, x 47514933, y 5356473, z 45026230 }, corner-111 { scale-factor 1000000, x 45714525, y 4898145, z 45766815 } } } }, { id 4, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 23, to 26 } }, surface brick { corner-000 { scale-factor 1000000, x 50501678, y 9736623, z 67496411 }, corner-001 { scale-factor 1000000, x 48587683, y 9747084, z 68076508 }, corner-010 { scale-factor 1000000, x 50506316, y 9748915, z 67511491 }, corner-011 { scale-factor 1000000, x 48592321, y 9759376, z 68091588 }, corner-100 { scale-factor 1000000, x 48866678, y 17135623, z 61968411 }, corner-101 { scale-factor 1000000, x 46952683, y 17146084, z 62548508 }, corner-110 { scale-factor 1000000, x 48871316, y 17147915, z 61983491 }, corner-111 { scale-factor 1000000, x 46957321, y 17158376, z 62563588 } } } }, { id 5, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 27, to 32 } }, surface brick { corner-000 { scale-factor 1000000, x 45572535, y 18446730, z 60354175 }, corner-001 { scale-factor 1000000, x 43897796, y 17881492, z 61289994 }, corner-010 { scale-factor 1000000, x 45562203, y 18460507, z 60344005 }, corner-011 { scale-factor 1000000, x 43887464, y 17895269, z 61279824 }, corner-100 { scale-factor 1000000, x 42678535, y 7630730, z 48642175 }, corner-101 { scale-factor 1000000, x 41003796, y 7065492, z 49577994 }, corner-110 { scale-factor 1000000, x 42668203, y 7644507, z 48632005 }, corner-111 { scale-factor 1000000, x 40993464, y 7079269, z 49567824 } } } }, { id 6, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 33, to 36 } }, surface brick { corner-000 { scale-factor 1000000, x 41656520, y 6359664, z 45895635 }, corner-001 { scale-factor 1000000, x 43237552, y 6280799, z 44673294 }, corner-010 { scale-factor 1000000, x 41668447, y 6365200, z 45910705 }, corner-011 { scale-factor 1000000, x 43249479, y 6286335, z 44688364 }, corner-100 { scale-factor 1000000, x 43051520, y -3244335, z 48319635 }, corner-101 { scale-factor 1000000, x 44632552, y -3323200, z 47097294 }, corner-110 { scale-factor 1000000, x 43063447, y -3238799, z 48334705 }, corner-111 { scale-factor 1000000, x 44644479, y -3317664, z 47112364 } } } }, { id 7, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 49, to 52 } }, surface brick { corner-000 { scale-factor 1000000, x 44950919, y 7962804, z 68216532 }, corner-001 { scale-factor 1000000, x 43083965, y 8212377, z 68888987 }, corner-010 { scale-factor 1000000, x 44958034, y 7971622, z 68233012 }, corner-011 { scale-factor 1000000, x 43091080, y 8221195, z 68905467 }, corner-100 { scale-factor 1000000, x 44496919, y 16847804, z 63658532 }, corner-101 { scale-factor 1000000, x 42629965, y 17097377, z 64330987 }, corner-110 { scale-factor 1000000, x 44504034, y 16856622, z 63675012 }, corner-111 { scale-factor 1000000, x 42637080, y 17106195, z 64347467 } } } }, { id 8, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 53, to 59 } }, surface brick { corner-000 { scale-factor 1000000, x 41573240, y 17147445, z 62079090 }, corner-001 { scale-factor 1000000, x 39679117, y 17086715, z 62718316 }, corner-010 { scale-factor 1000000, x 41568882, y 17163284, z 62067683 }, corner-011 { scale-factor 1000000, x 39674759, y 17102554, z 62706909 }, corner-100 { scale-factor 1000000, x 36875240, y 4999445, z 47004090 }, corner-101 { scale-factor 1000000, x 34981117, y 4938715, z 47643316 }, corner-110 { scale-factor 1000000, x 36870882, y 5015284, z 46992683 }, corner-111 { scale-factor 1000000, x 34976759, y 4954554, z 47631909 } } } }, { id 9, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 64, to 67 } }, surface brick { corner-000 { scale-factor 1000000, x 37296093, y -3687069, z 54354060 }, corner-001 { scale-factor 1000000, x 35897761, y -4497502, z 55532137 }, corner-010 { scale-factor 1000000, x 37308238, y -3702497, z 54357862 }, corner-011 { scale-factor 1000000, x 35909906, y -4512930, z 55535939 }, corner-100 { scale-factor 1000000, x 40710093, y 751930, z 61460060 }, corner-101 { scale-factor 1000000, x 39311761, y -58502, z 62638137 }, corner-110 { scale-factor 1000000, x 40722238, y 736502, z 61463862 }, corner-111 { scale-factor 1000000, x 39323906, y -73930, z 62641939 } } } }, { id 10, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 74, to 78 } }, surface brick { corner-000 { scale-factor 1000000, x 42087143, y 8277334, z 68448618 }, corner-001 { scale-factor 1000000, x 40304064, y 7728867, z 69169598 }, corner-010 { scale-factor 1000000, x 42091935, y 8285132, z 68466401 }, corner-011 { scale-factor 1000000, x 40308856, y 7736665, z 69187381 }, corner-100 { scale-factor 1000000, x 37422143, y 18946334, z 65027618 }, corner-101 { scale-factor 1000000, x 35639064, y 18397867, z 65748598 }, corner-110 { scale-factor 1000000, x 37426935, y 18954132, z 65045401 }, corner-111 { scale-factor 1000000, x 35643856, y 18405665, z 65766381 } } } }, { id 11, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 86, to 94 } }, surface brick { corner-000 { scale-factor 1000000, x 35234160, y 16569633, z 57952910 }, corner-001 { scale-factor 1000000, x 36768043, y 15703639, z 58900147 }, corner-010 { scale-factor 1000000, x 35221956, y 16564360, z 57967852 }, corner-011 { scale-factor 1000000, x 36755839, y 15698366, z 58915089 }, corner-100 { scale-factor 1000000, x 30971160, y -1931366, z 47941910 }, corner-101 { scale-factor 1000000, x 32505043, y -2797360, z 48889147 }, corner-110 { scale-factor 1000000, x 30958956, y -1936639, z 47956852 }, corner-111 { scale-factor 1000000, x 32492839, y -2802633, z 48904089 } } } }, { id 12, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 96, to 99 } }, surface brick { corner-000 { scale-factor 1000000, x 31308955, y -3429173, z 55522809 }, corner-001 { scale-factor 1000000, x 31549119, y -5110083, z 56579626 }, corner-010 { scale-factor 1000000, x 31326880, y -3431916, z 55514373 }, corner-011 { scale-factor 1000000, x 31567044, y -5112826, z 56571190 }, corner-100 { scale-factor 1000000, x 35008955, y 1113826, z 61907809 }, corner-101 { scale-factor 1000000, x 35249119, y -567083, z 62964626 }, corner-110 { scale-factor 1000000, x 35026880, y 1111083, z 61899373 }, corner-111 { scale-factor 1000000, x 35267044, y -569826, z 62956190 } } } }, { id 13, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 104, to 108 } }, surface brick { corner-000 { scale-factor 1000000, x 36695224, y 7929082, z 70131232 }, corner-001 { scale-factor 1000000, x 34850773, y 7630803, z 70844695 }, corner-010 { scale-factor 1000000, x 36701226, y 7935196, z 70149304 }, corner-011 { scale-factor 1000000, x 34856775, y 7636917, z 70862767 }, corner-100 { scale-factor 1000000, x 33755224, y 19268082, z 67271232 }, corner-101 { scale-factor 1000000, x 31910773, y 18969803, z 67984695 }, corner-110 { scale-factor 1000000, x 33761226, y 19274196, z 67289304 }, corner-111 { scale-factor 1000000, x 31916775, y 18975917, z 68002767 } } } }, { id 14, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 110, to 117 } }, surface brick { corner-000 { scale-factor 1000000, x 29268824, y 16047898, z 60932209 }, corner-001 { scale-factor 1000000, x 31112192, y 15362815, z 61296428 }, corner-010 { scale-factor 1000000, x 29261807, y 16037184, z 60947571 }, corner-011 { scale-factor 1000000, x 31105175, y 15352101, z 61311790 }, corner-100 { scale-factor 1000000, x 25827824, y 5898, z 48173209 }, corner-101 { scale-factor 1000000, x 27671192, y -679184, z 48537428 }, corner-110 { scale-factor 1000000, x 25820807, y -4815, z 48188571 }, corner-111 { scale-factor 1000000, x 27664175, y -689898, z 48552790 } } } }, { id 15, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 136, to 143 } }, surface brick { corner-000 { scale-factor 1000000, x 24084712, y 16363680, z 60808731 }, corner-001 { scale-factor 1000000, x 25351909, y 16973321, z 59386568 }, corner-010 { scale-factor 1000000, x 24100090, y 16356678, z 60819431 }, corner-011 { scale-factor 1000000, x 25367287, y 16966319, z 59397268 }, corner-100 { scale-factor 1000000, x 22366712, y -1354319, z 51682731 }, corner-101 { scale-factor 1000000, x 23633909, y -744678, z 50260568 }, corner-110 { scale-factor 1000000, x 22382090, y -1361321, z 51693431 }, corner-111 { scale-factor 1000000, x 23649287, y -751680, z 50271268 } } } }, { id 16, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 153, to 156 } }, surface brick { corner-000 { scale-factor 1000000, x 29974990, y -11159730, z 71478106 }, corner-001 { scale-factor 1000000, x 28794883, y -10525717, z 72963156 }, corner-010 { scale-factor 1000000, x 29969116, y -11144282, z 71466843 }, corner-011 { scale-factor 1000000, x 28789009, y -10510269, z 72951893 }, corner-100 { scale-factor 1000000, x 24433990, y -15214730, z 68806106 }, corner-101 { scale-factor 1000000, x 23253883, y -14580717, z 70291156 }, corner-110 { scale-factor 1000000, x 24428116, y -15199282, z 68794843 }, corner-111 { scale-factor 1000000, x 23248009, y -14565269, z 70279893 } } } }, { id 17, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 158, to 161 } }, surface brick { corner-000 { scale-factor 1000000, x 24495448, y -16846611, z 74873979 }, corner-001 { scale-factor 1000000, x 24072398, y -16678335, z 76821467 }, corner-010 { scale-factor 1000000, x 24513601, y -16853664, z 74878532 }, corner-011 { scale-factor 1000000, x 24090551, y -16685388, z 76826020 }, corner-100 { scale-factor 1000000, x 27765448, y -8440611, z 74857979 }, corner-101 { scale-factor 1000000, x 27342398, y -8272335, z 76805467 }, corner-110 { scale-factor 1000000, x 27783601, y -8447664, z 74862532 }, corner-111 { scale-factor 1000000, x 27360551, y -8279388, z 76810020 } } } }, { id 18, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 163, to 168 } }, surface brick { corner-000 { scale-factor 1000000, x 24612250, y -2049506, z 77839346 }, corner-001 { scale-factor 1000000, x 24598126, y -3514765, z 76478164 }, corner-010 { scale-factor 1000000, x 24595873, y -2057234, z 77847835 }, corner-011 { scale-factor 1000000, x 24581749, y -3522493, z 76486653 }, corner-100 { scale-factor 1000000, x 15198250, y 7140493, z 68044346 }, corner-101 { scale-factor 1000000, x 15184126, y 5675234, z 66683164 }, corner-110 { scale-factor 1000000, x 15181873, y 7132765, z 68052835 }, corner-111 { scale-factor 1000000, x 15167749, y 5667506, z 66691653 } } } }, { id 19, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 169, to 177 } }, surface brick { corner-000 { scale-factor 1000000, x 13163186, y 3271104, z 72072445 }, corner-001 { scale-factor 1000000, x 12318459, y 1954065, z 70826715 }, corner-010 { scale-factor 1000000, x 13165540, y 3283934, z 72057284 }, corner-011 { scale-factor 1000000, x 12320813, y 1966895, z 70811554 }, corner-100 { scale-factor 1000000, x 32704186, y -5283895, z 67866445 }, corner-101 { scale-factor 1000000, x 31859459, y -6600934, z 66620715 }, corner-110 { scale-factor 1000000, x 32706540, y -5271065, z 67851284 }, corner-111 { scale-factor 1000000, x 31861813, y -6588104, z 66605554 } } } }, { id 20, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 179, to 182 } }, surface brick { corner-000 { scale-factor 1000000, x 33784058, y -9171524, z 67920784 }, corner-001 { scale-factor 1000000, x 35328397, y -8933272, z 69169084 }, corner-010 { scale-factor 1000000, x 33793602, y -9160727, z 67906915 }, corner-011 { scale-factor 1000000, x 35337941, y -8922475, z 69155215 }, corner-100 { scale-factor 1000000, x 29571058, y -803524, z 71535784 }, corner-101 { scale-factor 1000000, x 31115397, y -565272, z 72784084 }, corner-110 { scale-factor 1000000, x 29580602, y -792727, z 71521915 }, corner-111 { scale-factor 1000000, x 31124941, y -554475, z 72770215 } } } }, { id 21, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 223, to 227 } }, surface brick { corner-000 { scale-factor 1000000, x 41015110, y 21667662, z 76324929 }, corner-001 { scale-factor 1000000, x 41526938, y 22917489, z 74849814 }, corner-010 { scale-factor 1000000, x 41017061, y 21682510, z 76338185 }, corner-011 { scale-factor 1000000, x 41528889, y 22932337, z 74863070 }, corner-100 { scale-factor 1000000, x 53835110, y 18447662, z 78044929 }, corner-101 { scale-factor 1000000, x 54346938, y 19697489, z 76569814 }, corner-110 { scale-factor 1000000, x 53837061, y 18462510, z 78058185 }, corner-111 { scale-factor 1000000, x 54348889, y 19712337, z 76583070 } } } }, { id 22, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 228, to 232 } }, surface brick { corner-000 { scale-factor 1000000, x 53172515, y 17552515, z 78906123 }, corner-001 { scale-factor 1000000, x 52790700, y 16434805, z 80520106 }, corner-010 { scale-factor 1000000, x 53179299, y 17567194, z 78917893 }, corner-011 { scale-factor 1000000, x 52797484, y 16449484, z 80531876 }, corner-100 { scale-factor 1000000, x 41586515, y 22408515, z 79528123 }, corner-101 { scale-factor 1000000, x 41204700, y 21290805, z 81142106 }, corner-110 { scale-factor 1000000, x 41593299, y 22423194, z 79539893 }, corner-111 { scale-factor 1000000, x 41211484, y 21305484, z 81153876 } } } }, { id 23, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 239, to 242 } }, surface brick { corner-000 { scale-factor 1000000, x 48443703, y 31174388, z 72274498 }, corner-001 { scale-factor 1000000, x 49572060, y 29858597, z 73272248 }, corner-010 { scale-factor 1000000, x 48427939, y 31169402, z 72285751 }, corner-011 { scale-factor 1000000, x 49556296, y 29853611, z 73283501 }, corner-100 { scale-factor 1000000, x 46039703, y 24223388, z 65826498 }, corner-101 { scale-factor 1000000, x 47168060, y 22907597, z 66824248 }, corner-110 { scale-factor 1000000, x 46023939, y 24218402, z 65837751 }, corner-111 { scale-factor 1000000, x 47152296, y 22902611, z 66835501 } } } }, { id 24, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 243, to 247 } }, surface brick { corner-000 { scale-factor 1000000, x 43060292, y 22080372, z 69516155 }, corner-001 { scale-factor 1000000, x 42574350, y 23967273, z 69967228 }, corner-010 { scale-factor 1000000, x 43055649, y 22074726, z 69534771 }, corner-011 { scale-factor 1000000, x 42569707, y 23961627, z 69985844 }, corner-100 { scale-factor 1000000, x 53633292, y 24031372, z 72745155 }, corner-101 { scale-factor 1000000, x 53147350, y 25918273, z 73196228 }, corner-110 { scale-factor 1000000, x 53628649, y 24025726, z 72763771 }, corner-111 { scale-factor 1000000, x 53142707, y 25912627, z 73214844 } } } }, { id 25, descr { other-comment "helix" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 248, to 255 } }, surface cylinder { axis-top { scale-factor 1000000, x 58184000, y 29381000, z 62009000 }, axis-bottom { scale-factor 1000000, x 57952000, y 30028000, z 73088000 }, radius { scale-factor 1, scaled-integer-value 2 } } } }, { id 26, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 266, to 270 } }, surface brick { corner-000 { scale-factor 1000000, x 53044235, y 33584979, z 61161990 }, corner-001 { scale-factor 1000000, x 54052781, y 35291486, z 61427827 }, corner-010 { scale-factor 1000000, x 53031218, y 33594513, z 61150172 }, corner-011 { scale-factor 1000000, x 54039764, y 35301020, z 61416009 }, corner-100 { scale-factor 1000000, x 45580235, y 36365979, z 71626990 }, corner-101 { scale-factor 1000000, x 46588781, y 38072486, z 71892827 }, corner-110 { scale-factor 1000000, x 45567218, y 36375513, z 71615172 }, corner-111 { scale-factor 1000000, x 46575764, y 38082020, z 71881009 } } } }, { id 27, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 271, to 275 } }, surface brick { corner-000 { scale-factor 1000000, x 46344937, y 34251910, z 72293927 }, corner-001 { scale-factor 1000000, x 46305822, y 32287013, z 72664943 }, corner-010 { scale-factor 1000000, x 46326177, y 34250986, z 72287056 }, corner-011 { scale-factor 1000000, x 46287062, y 32286089, z 72658072 }, corner-100 { scale-factor 1000000, x 50781937, y 31934910, z 60490927 }, corner-101 { scale-factor 1000000, x 50742822, y 29970013, z 60861943 }, corner-110 { scale-factor 1000000, x 50763177, y 31933986, z 60484056 }, corner-111 { scale-factor 1000000, x 50724062, y 29969089, z 60855072 } } } }, { id 28, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 280, to 284 } }, surface brick { corner-000 { scale-factor 1000000, x 41698291, y 42376900, z 58296664 }, corner-001 { scale-factor 1000000, x 41261800, y 44251692, z 58839463 }, corner-010 { scale-factor 1000000, x 41692199, y 42370307, z 58314536 }, corner-011 { scale-factor 1000000, x 41255708, y 44245099, z 58857335 }, corner-100 { scale-factor 1000000, x 53011291, y 43747900, z 62658664 }, corner-101 { scale-factor 1000000, x 52574800, y 45622692, z 63201463 }, corner-110 { scale-factor 1000000, x 53005199, y 43741307, z 62676536 }, corner-111 { scale-factor 1000000, x 52568708, y 45616099, z 63219335 } } } }, { id 29, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 290, to 294 } }, surface brick { corner-000 { scale-factor 1000000, x 51021931, y 40750620, z 67490825 }, corner-001 { scale-factor 1000000, x 52219204, y 40938892, z 65899885 }, corner-010 { scale-factor 1000000, x 51012795, y 40735107, z 67482114 }, corner-011 { scale-factor 1000000, x 52210068, y 40923379, z 65891174 }, corner-100 { scale-factor 1000000, x 42725931, y 48619620, z 62178825 }, corner-101 { scale-factor 1000000, x 43923204, y 48807892, z 60587885 }, corner-110 { scale-factor 1000000, x 42716795, y 48604107, z 62170114 }, corner-111 { scale-factor 1000000, x 43914068, y 48792379, z 60579174 } } } }, { id 30, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 300, to 303 } }, surface brick { corner-000 { scale-factor 1000000, x 47515154, y 45592757, z 50123854 }, corner-001 { scale-factor 1000000, x 47219434, y 47479318, z 49529348 }, corner-010 { scale-factor 1000000, x 47534565, y 45596681, z 50126651 }, corner-011 { scale-factor 1000000, x 47238845, y 47483242, z 49532145 }, corner-100 { scale-factor 1000000, x 49329154, y 43038757, z 41116854 }, corner-101 { scale-factor 1000000, x 49033434, y 44925318, z 40522348 }, corner-110 { scale-factor 1000000, x 49348565, y 43042681, z 41119651 }, corner-111 { scale-factor 1000000, x 49052845, y 44929242, z 40525145 } } } }, { id 31, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 307, to 313 } }, surface brick { corner-000 { scale-factor 1000000, x 51959534, y 46283654, z 33419867 }, corner-001 { scale-factor 1000000, x 51603462, y 48163991, z 34000856 }, corner-010 { scale-factor 1000000, x 51962537, y 46290008, z 33401143 }, corner-011 { scale-factor 1000000, x 51606465, y 48170345, z 33982132 }, corner-100 { scale-factor 1000000, x 34455534, y 44068654, z 29860867 }, corner-101 { scale-factor 1000000, x 34099462, y 45948991, z 30441856 }, corner-110 { scale-factor 1000000, x 34458537, y 44075008, z 29842143 }, corner-111 { scale-factor 1000000, x 34102465, y 45955345, z 30423132 } } } }, { id 32, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 324, to 327 } }, surface brick { corner-000 { scale-factor 1000000, x 44357173, y 50069281, z 47985364 }, corner-001 { scale-factor 1000000, x 44738918, y 51997555, z 47616542 }, corner-010 { scale-factor 1000000, x 44373081, y 50068444, z 47997457 }, corner-011 { scale-factor 1000000, x 44754826, y 51996718, z 47628635 }, corner-100 { scale-factor 1000000, x 49899173, y 47544281, z 40520364 }, corner-101 { scale-factor 1000000, x 50280918, y 49472555, z 40151542 }, corner-110 { scale-factor 1000000, x 49915081, y 47543444, z 40532457 }, corner-111 { scale-factor 1000000, x 50296826, y 49471718, z 40163635 } } } }, { id 33, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 328, to 336 } }, surface brick { corner-000 { scale-factor 1000000, x 50874560, y 50220686, z 36401317 }, corner-001 { scale-factor 1000000, x 50596195, y 52199220, z 36490293 }, corner-010 { scale-factor 1000000, x 50883804, y 50222779, z 36383706 }, corner-011 { scale-factor 1000000, x 50605439, y 52201313, z 36472682 }, corner-100 { scale-factor 1000000, x 29709560, y 47755686, z 24999317 }, corner-101 { scale-factor 1000000, x 29431195, y 49734220, z 25088293 }, corner-110 { scale-factor 1000000, x 29718804, y 47757779, z 24981706 }, corner-111 { scale-factor 1000000, x 29440439, y 49736313, z 25070682 } } } }, { id 34, descr { other-comment "helix" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 340, to 348 } }, surface cylinder { axis-top { scale-factor 1000000, x 36127000, y 48237000, z 43541000 }, axis-bottom { scale-factor 1000000, x 26947000, y 49879000, z 37002000 }, radius { scale-factor 1, scaled-integer-value 2 } } } }, { id 35, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 352, to 355 } }, surface brick { corner-000 { scale-factor 1000000, x 43177213, y 55139966, z 46050898 }, corner-001 { scale-factor 1000000, x 43730429, y 57047703, z 45817463 }, corner-010 { scale-factor 1000000, x 43189570, y 55138296, z 46066536 }, corner-011 { scale-factor 1000000, x 43742786, y 57046033, z 45833101 }, corner-100 { scale-factor 1000000, x 50487213, y 52275966, z 39968898 }, corner-101 { scale-factor 1000000, x 51040429, y 54183703, z 39735463 }, corner-110 { scale-factor 1000000, x 50499570, y 52274296, z 39984536 }, corner-111 { scale-factor 1000000, x 51052786, y 54182033, z 39751101 } } } }, { id 36, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 356, to 362 } }, surface brick { corner-000 { scale-factor 1000000, x 51138932, y 54244374, z 36727598 }, corner-001 { scale-factor 1000000, x 51068258, y 56243002, z 36749749 }, corner-010 { scale-factor 1000000, x 51151741, y 54244997, z 36712250 }, corner-011 { scale-factor 1000000, x 51081067, y 56243625, z 36734401 }, corner-100 { scale-factor 1000000, x 36119932, y 53852374, z 24177598 }, corner-101 { scale-factor 1000000, x 36049258, y 55851002, z 24199749 }, corner-110 { scale-factor 1000000, x 36132741, y 53852997, z 24162250 }, corner-111 { scale-factor 1000000, x 36062067, y 55851625, z 24184401 } } } }, { id 37, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 367, to 370 } }, surface brick { corner-000 { scale-factor 1000000, x 29177784, y 58601534, z 31855177 }, corner-001 { scale-factor 1000000, x 30008937, y 60414820, z 31709648 }, corner-010 { scale-factor 1000000, x 29163062, y 58609179, z 31866351 }, corner-011 { scale-factor 1000000, x 29994215, y 60422465, z 31720822 }, corner-100 { scale-factor 1000000, x 33769784, y 57066534, z 38955177 }, corner-101 { scale-factor 1000000, x 34600937, y 58879820, z 38809648 }, corner-110 { scale-factor 1000000, x 33755062, y 57074179, z 38966351 }, corner-111 { scale-factor 1000000, x 34586215, y 58887465, z 38820822 } } } }, { id 38, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 376, to 380 } }, surface brick { corner-000 { scale-factor 1000000, x 43073823, y 58074677, z 44952087 }, corner-001 { scale-factor 1000000, x 42986847, y 60072774, z 44945439 }, corner-010 { scale-factor 1000000, x 43085152, y 58075225, z 44968560 }, corner-011 { scale-factor 1000000, x 42998176, y 60073322, z 44961912 }, corner-100 { scale-factor 1000000, x 53549823, y 58506677, z 37733087 }, corner-101 { scale-factor 1000000, x 53462847, y 60504774, z 37726439 }, corner-110 { scale-factor 1000000, x 53561152, y 58507225, z 37749560 }, corner-111 { scale-factor 1000000, x 53474176, y 60505322, z 37742912 } } } }, { id 39, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 389, to 397 } }, surface brick { corner-000 { scale-factor 1000000, x 50072475, y 57782144, z 30785338 }, corner-001 { scale-factor 1000000, x 49225166, y 56715305, z 32249552 }, corner-010 { scale-factor 1000000, x 50070833, y 57798694, z 30796447 }, corner-011 { scale-factor 1000000, x 49223524, y 56731855, z 32260661 }, corner-100 { scale-factor 1000000, x 31046475, y 61478144, z 22468338 }, corner-101 { scale-factor 1000000, x 30199166, y 60411305, z 23932552 }, corner-110 { scale-factor 1000000, x 31044833, y 61494694, z 22479447 }, corner-111 { scale-factor 1000000, x 30197524, y 60427855, z 23943661 } } } }, { id 40, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 399, to 402 } }, surface brick { corner-000 { scale-factor 1000000, x 30866097, y 64009105, z 30068406 }, corner-001 { scale-factor 1000000, x 29315578, y 64462072, z 31247690 }, corner-010 { scale-factor 1000000, x 30860421, y 63989927, z 30068309 }, corner-011 { scale-factor 1000000, x 29309902, y 64442894, z 31247593 }, corner-100 { scale-factor 1000000, x 36378097, y 62338105, z 37957406 }, corner-101 { scale-factor 1000000, x 34827578, y 62791072, z 39136690 }, corner-110 { scale-factor 1000000, x 36372421, y 62318927, z 37957309 }, corner-111 { scale-factor 1000000, x 34821902, y 62771894, z 39136593 } } } }, { id 41, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 409, to 413 } }, surface brick { corner-000 { scale-factor 1000000, x 42862895, y 63821617, z 42872182 }, corner-001 { scale-factor 1000000, x 42912147, y 65673472, z 42118386 }, corner-010 { scale-factor 1000000, x 42869852, y 63828527, z 42889613 }, corner-011 { scale-factor 1000000, x 42919104, y 65680382, z 42135817 }, corner-100 { scale-factor 1000000, x 54404895, y 61942617, z 39010182 }, corner-101 { scale-factor 1000000, x 54454147, y 63794472, z 38256386 }, corner-110 { scale-factor 1000000, x 54411852, y 61949527, z 39027613 }, corner-111 { scale-factor 1000000, x 54461104, y 63801382, z 38273817 } } } }, { id 42, descr { other-comment "strand" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 415, to 420 } }, surface brick { corner-000 { scale-factor 1000000, x 49649483, y 67396936, z 31653562 }, corner-001 { scale-factor 1000000, x 49752389, y 65501210, z 32282556 }, corner-010 { scale-factor 1000000, x 49635610, y 67400789, z 31667443 }, corner-011 { scale-factor 1000000, x 49738516, y 65505063, z 32296437 }, corner-100 { scale-factor 1000000, x 37191483, y 62994936, z 20424562 }, corner-101 { scale-factor 1000000, x 37294389, y 61099210, z 21053556 }, corner-110 { scale-factor 1000000, x 37177610, y 62998789, z 20438443 }, corner-111 { scale-factor 1000000, x 37280516, y 61103063, z 21067437 } } } }, { id 43, descr { other-comment "helix" }, coordinates literal surface { contents residues interval { { molecule-id 1, from 427, to 436 } }, surface cylinder { axis-top { scale-factor 1000000, x 45117000, y 70207000, z 40390000 }, axis-bottom { scale-factor 1000000, x 35448000, y 70997000, z 31065000 }, radius { scale-factor 1, scaled-integer-value 2 } } } } } } } }, sequences { seq { id { pdb { mol "1IGR", chain 65, rel std { year 1998, month 9, day 28 } }, gi 6435822 }, descr { pdb { deposition std { year 1998, month 9, day 28 }, class "Hormone Receptor", compound { "Type 1 Insulin-Like Growth Factor Receptor (Domains 1-3)" }, source { "Mol_id: 1; Organism_scientific: Homo Sapiens; Organism_common: Human; Organ: Placenta; Cellular_location: Cytoplasmic Membrane; Expression_system: Cricetulus Griseus; Expression_system_cell_line: Lec8; Expression_system_collection: Crl:1737; Expression_system_cellular_location: Secreted; Expression_system_plasmid: Pee14IGF-1r462; Other_details: Large Scale Cell Culture In A Cellgen Plus Bioreactor" } }, source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } } }, inst { repr raw, mol aa, length 478, seq-data iupacaa "EICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVIT EYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLI LDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGS CSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGS QSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSH ALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQ SKGDINTRNNGERASCESDVDDDDKEQKLISEEDLN" } } }, style-dictionary { global-style { protein-backbone { type trace, style tube-worm, color-scheme domain, user-color { scale-factor 10000, red 5000, green 5000, blue 5000, alpha 10000 } }, nucleotide-backbone { type trace, style tube-worm, color-scheme domain, user-color { scale-factor 10000, red 5000, green 5000, blue 5000, alpha 10000 } }, protein-sidechains { is-on FALSE, style wire, color-scheme element, user-color { scale-factor 10000, red 5000, green 5000, blue 5000, alpha 10000 } }, nucleotide-sidechains { is-on FALSE, style wire, color-scheme element, user-color { scale-factor 10000, red 5000, green 5000, blue 5000, alpha 10000 } }, heterogens { is-on TRUE, style ball-and-stick, color-scheme element, user-color { scale-factor 10000, red 5000, green 5000, blue 5000, alpha 10000 } }, solvents { is-on FALSE, style ball-and-stick, color-scheme element, user-color { scale-factor 10000, red 5000, green 5000, blue 5000, alpha 10000 } }, connections { is-on TRUE, style tubes, color-scheme user-select, user-color { scale-factor 10000, red 9000, green 9000, blue 10000, alpha 10000 } }, helix-objects { is-on TRUE, style with-arrows, color-scheme domain, user-color { scale-factor 10000, red 5000, green 5000, blue 5000, alpha 10000 } }, strand-objects { is-on TRUE, style with-arrows, color-scheme domain, user-color { scale-factor 10000, red 5000, green 5000, blue 5000, alpha 10000 } }, virtual-disulfides-on TRUE, virtual-disulfide-color { scale-factor 10000, red 9300, green 5500, blue 500, alpha 10000 }, hydrogens-on TRUE, background-color { scale-factor 10000, red 0, green 0, blue 0, alpha 10000 }, scale-factor 10000, space-fill-proportion 10000, ball-radius 4000, stick-radius 2000, tube-radius 3000, tube-worm-radius 3000, helix-radius 18000, strand-width 20000, strand-thickness 5000, protein-labels { spacing 0, type three-letter, number sequential, termini FALSE, white TRUE }, nucleotide-labels { spacing 0, type three-letter, number sequential, termini FALSE, white TRUE }, ion-labels TRUE } }, user-annotations { view { camera-distance { 213568009310686, 10, -12 }, camera-angle-rad { 535607457986682, 10, -15 }, camera-look-at-X { -359134584954426, 10, -14 }, camera-look-at-Y { 897836462386064, 10, -15 }, camera-clip-near { 985689344127709, 10, -13 }, camera-clip-far { 33334697795879, 10, -11 }, matrix { m0 { 179474040865898, 10, -15 }, m1 { 67796379327774, 10, -14 }, m2 { -712852120399475, 10, -15 }, m3 { 0, 10, 0 }, m4 { -698439359664917, 10, -15 }, m5 { 598112761974335, 10, -15 }, m6 { 392995893955231, 10, -15 }, m7 { 0, 10, 0 }, m8 { 692801415920258, 10, -15 }, m9 { 427350372076035, 10, -15 }, m10 { 580861687660217, 10, -15 }, m11 { 0, 10, 0 }, m12 { -239928512573242, 10, -13 }, m13 { -678166122436523, 10, -13 }, m14 { -138399534225464, 10, -13 }, m15 { 1, 10, 0 } }, rotation-center { x { 404173733333332, 10, -13 }, y { 292434382051282, 10, -13 }, z { 536427492307691, 10, -13 } } } } }